Real Time Touch



new TOP 200 Companies filing patents this week

new Companies with the Most Patent Filings (2010+)




Real Time Touch

Similar
Filing Names

Erasmus University Medical Center Rotterdam
Erasmus University Medical Center Rotterdam_20100107

Erasmus University Medical Center Rotterdam patents


Recent patent applications related to Erasmus University Medical Center Rotterdam. Erasmus University Medical Center Rotterdam is listed as an Agent/Assignee. Note: Erasmus University Medical Center Rotterdam may have other listings under different names/spellings. We're not affiliated with Erasmus University Medical Center Rotterdam, we're just tracking patents.

ARCHIVE: New 2018 2017 2016 2015 2014 2013 2012 2011 2010 2009 | Company Directory "E" | Erasmus University Medical Center Rotterdam-related inventors


 new patent  A method of analysing an image for assessing a condition of an organ of a patient

A method is disclosed for analysing an image to assess a condition of an organ of a patient represented in the image. The method includes initially selecting a spatial resolution for an inspection matrix having a number of inspection regions each delimiting a part of the image. ... Erasmus University Medical Center Rotterdam

Methods, reagents and kits for flow cytometric immunophenotyping

The invention relates to the field of flow cytometry and more particularly to a panel of antibody reagents conjugated to fluorescent compounds. Provided are reagent compositions, comprising at least eight distinct fluorochrome-conjugated antibodies comprising a set of at least there identification antibodies for the identification of a leukocyte population of interest and at least four characterization antibodies for further characterization and/or classification of said leukocyte population. ... Erasmus University Medical Center Rotterdam

Use of cabazitaxel in the treatment of prostate cancer

The present invention relates to cabazitaxel for use in a method for treating an ar-v7-positive patient suffering from prostate cancer comprising determining the ar-v7-status in said patient and administering cabazitaxel. The invention also relates to a method of identifying patients with prostate cancer, eligible for treatment with cabazitaxel comprising testing a biological sample from the patient for the presence of ar-v7 circulating tumor cells, wherein the patient is eligible for treatment with said cabazitaxel if circulating tumor cells in said sample test positive for ar-v7. ... Erasmus University Medical Center Rotterdam

Metapneumovirus strains and their use in vaccine formulations and as vectors for expression of antigenic sequences

Provided is an isolated mammalian negative strand rna virus, metapneumovirus (mpv), within the sub-family pneumoviridae, of the family paramyxoviridae. Also provided are isolated mammalian negative strand rna viruses identifiable as phylogenetically corresponding or relating to the genus metapneumovirus and components thereof. ... Erasmus University Medical Center Rotterdam

Virus causing respiratory tract illness in susceptible mammals

The invention relates to the field of virology. The invention provides an isolated essentially mammalian negative-sense single-stranded rna virus (mpv) within the subfamily pneumovirinae of the family paramyxoviridae and identifiable as phylogenetically corresponding to the genus metapneumovirus and components thereof.. ... Erasmus University Medical Center Rotterdam

Reagents, methods and kits for diagnosing primary immunodeficiencies

This invention relates to the field of primary immunodeficiencies (pid), more specifically to means and method for the diagnosis of pid of the lymphoid system. Provided are unique reagent compositions for the flow cytometric immunophenotyping of leukocytes comprising fluorochrome-conjugated antibodies directed against various specific combinations of markers. ... Erasmus University Medical Center Rotterdam

Anti-senescence compounds and uses thereof

The invention relates to a peptide comprising the amino acid sequence ltlrkepaseiaqsileaysqngwanrrsggkrp, wherein the amino acids in said amino acid sequence are d-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders. . ... Erasmus University Medical Center Rotterdam

Labelling device and system comprising such device

A first aspect provides a labelling device for providing an object with a printed label. The device comprises a first transportation module, a labelling module comprising a label gripper and a gripper driving module for moving the gripper between a label pick-up position and a label application position, and a second transportation module. ... Erasmus University Medical Center Rotterdam

Erasmus University Medical Center Rotterdam

. . ... Erasmus University Medical Center Rotterdam

Methods for characterizing alternatively or aberrantly spliced mrna isoforms

The disclosure provides method and kits for characterizing spliced m rna isoforms. The disclosure also provides methods of screening for mutations and oligonucleotides that modulate splicing.. ... Erasmus University Medical Center Rotterdam

Antisense oligonucleotides useful in treatment of pompe disease

The present invention is directed to antisense oligomeric compounds that may be used in the treatment pompe disease as well as method for modulating the splicing of the gaa gene and method to treat pompe disease. Also pharmaceutical compositions comprising the antisense oligomeric compounds are part of the invention.. ... Erasmus University Medical Center Rotterdam

Virus causing respiratory tract illness in susceptible mammals

The invention relates to the field of virology. The invention provides an isolated essentially mammalian negative-sense single-stranded rna virus (mpv) within the subfamily pneumovirinae of the family paramyxoviridae and identifiable as phylogenetically corresponding to the genus metapneumovirus and components thereof.. ... Erasmus University Medical Center Rotterdam

Method for the treatment of multiple myeloma

The disclosure is in the field of medical treatments and relates to the treatment of multiple myeloma (mm). In particular, it provides means and methods for the improved treatment of certain subgroups of mm patients, more in particular, patients with a poor prognosis. ... Erasmus University Medical Center Rotterdam

Metapneumovirus strains and their use in vaccine formulations and as vectors for expression of antigenic sequences

Provided is an isolated mammalian negative strand rna virus, metapneumovirus (mpv), within the sub-family pneumoviridae, of the family paramyxoviridae. Also provided are isolated mammalian negative strand rna viruses identifiable as phylogenetically corresponding or relating to the genus metapneumovirus and components thereof. ... Erasmus University Medical Center Rotterdam








ARCHIVE: New 2018 2017 2016 2015 2014 2013 2012 2011 2010 2009



###

This listing is an abstract for educational and research purposes is only meant as a recent sample of applications filed, not a comprehensive history. Freshpatents.com is not affiliated or associated with Erasmus University Medical Center Rotterdam in any way and there may be associated servicemarks. This data is also published to the public by the USPTO and available for free on their website. Note that there may be alternative spellings for Erasmus University Medical Center Rotterdam with additional patents listed. Browse our Agent directory for other possible listings. Page by FreshPatents.com

###