Real Time Touch



new TOP 200 Companies filing patents this week

new Companies with the Most Patent Filings (2010+)




Real Time Touch

Fujifilm Corporation patents (2015 archive)


Recent patent applications related to Fujifilm Corporation. Fujifilm Corporation is listed as an Agent/Assignee. Note: Fujifilm Corporation may have other listings under different names/spellings. We're not affiliated with Fujifilm Corporation, we're just tracking patents.

ARCHIVE: New 2018 2017 2016 2015 2014 2013 2012 2011 2010 2009 | Company Directory "F" | Fujifilm Corporation-related inventors


12/31/15 / #20150381924

Lens device and position detection method of movable optical element

. . . . . . . . In a magnetic recording scale 41 fixed to an outer periphery of a rotary tube 20 which rotates around an optic axis depending on the movement of a zoom lens, a plurality of recording section 41a and recording section 41b pairs are provided in the rotational direction. A recording section 41b has a width less than a width of a recording section 41a . ... Fujifilm Corporation

12/31/15 / #20150381883

Image processing device, imaging device, program, and image processing method

Provided are an image processing device, an imaging device, and an image processing method which can perform focusing control using an intuitive operation. First and second images based on image signals that are output from an imaging element including first and second pixel groups on which an object image that passes through first and second regions of an imaging lens and is pupil-divided is formed are combined and displayed on a display unit having a touch panel. ... Fujifilm Corporation

12/31/15 / #20150380586

Laminated sheet and back sheet for solar cell modules

A laminated film having a support containing polyolefin as a main component, a polymer layer with an optical density of 2.0 or more, and an overcoat layer containing at least one of silicone-based resin and fluorine-based resin has both weather resistance and lightfastness.. . ... Fujifilm Corporation

12/31/15 / #20150380042

Optical information recording medium

An optical information recording medium includes at least one recording layer. The recording layer includes a recording material comprising a polymer compound to which a one-photon absorption dye is bonded, and a coupling strength Δ2 between the one-photon absorption dye and the polymer compound in the recording material is higher than a coupling strength estimated to be exerted between the same one-photon absorption dye and the same polymer compound if the one-photon absorption dye is dispersed in the polymer compound in the recording material.. ... Fujifilm Corporation

12/31/15 / #20150379726

Body motion detection device and method

A contrast calculating unit calculates, as each of a contrast of a high frequency component and a contrast of a low frequency component of a transformed radiographic image, a contrast in a gradient direction of an edge portion in an analysis region with each of analysis points set by an analysis point setting unit being the center of the analysis region. A ratio calculating unit calculates, for each gradient direction, a ratio of the contrast of the high frequency component to the contrast of the low frequency component. ... Fujifilm Corporation

12/31/15 / #20150379711

Radiation image processing device, radiation image processing method and program

It is possible to allow image processing on a radiation image such that the same effect of scattered radiation elimination as when imaging is actually performed using a grid is obtained. When performing processing for eliminating scattered radiation included in radiation transmitted through a subject m on a radiation image imaged by irradiating the subject m with radiation, a characteristic acquisition unit 32 acquires a virtual grid characteristic as a characteristic of a virtual grid assumed to be used to eliminate scattered radiation at the time of imaging of the radiation image. ... Fujifilm Corporation

12/31/15 / #20150379698

Medical image processing device, method for operating the same, and endoscope system

First rgb image signals are inputted. Color difference signals cr and cb are calculated from the first rgb image signals. ... Fujifilm Corporation

12/31/15 / #20150379695

Restoration filter generation device and method, image processing device and method, imaging device, and non-transitory computer-readable medium

A restoration filter generation device that generates a restoration filter to perform restoration processing on luminance system image data that is image data related to luminance, which is generated based on image data of respective colors of multiple colors obtained by an imaging device having an optical system, includes an information acquisition device acquiring transfer function information corresponding to point image distribution in the optical system, for each color of the multiple colors, and a restoration filter generation device generating the restoration filter based on the transfer function information acquired by the information acquisition device and generating the restoration filter that performs phase correction of the luminance system image data according to the transfer function information on a single color of the multiple colors.. . ... Fujifilm Corporation

12/31/15 / #20150379374

Image display device and method

Provided is a technique for reducing the amount of calculation and storage costs when an alignment process and/or an image quality correction process is performed on a plurality of radiological images in order to perform comparative reading. A correction amount calculation unit 22 calculates a correction amount for matching the position and/or image quality of radiological images other than a reference radiological image among a plurality of radiological images including the same photographic subject with the position and/or image quality of the reference radiological image for each of the other radiological images. ... Fujifilm Corporation

12/31/15 / #20150378485

Electroconductive film

An electroconductive film includes a transparent conductive layer having a plurality of electrodes which extend in one direction. The electrodes have different electrode widths depending on the site, and are configured of a plurality of polygonal cells formed of fine metal wires. ... Fujifilm Corporation

12/31/15 / #20150378461

Transparent conductive film and touch panel

A transparent conductive film having a transparent resin film containing a cyclic olefin resin and a conductive layer and having a thermal dimensional change rate in hot water at 100° c. For 60 seconds of from 0.01 to 0.2%, shows excellent adhesion between the transparent resin film and the conductive layer.. ... Fujifilm Corporation

12/31/15 / #20150378301

Image forming device

The present invention provides an image forming device comprising: a conveying member that conveys recording media; a first sensor that is provided at a first detection position, and that detects absence or presence of a recording medium; a second sensor that is provided at a second detection position; a plurality of sensor dogs that are provided at a rotating/supporting member that drives the conveying member; a timing sensor that detects passage of the sensor dogs and determines detection timings of the first sensor and the second sensor; and a judging device that judges that there is a jam when a recording medium is continuously detected at the first sensor or the second sensor, and that judges that there is a jam when there is inconsistency in information relating to the absence or presence of a recording medium from the first sensor and the second sensor.. . ... Fujifilm Corporation

12/31/15 / #20150378257

Pattern forming method, actinic ray-sensitive or radiation-sensitive resin composition, method of manufacturing electronic device, and electronic device

According to one example of the present application, there is provided a pattern forming method including: (i) forming a film by using an actinic ray-sensitive or radiation-sensitive resin composition containing (a) a specific resin and (b) a compound capable of generating an acid upon irradiation with an actinic ray or radiation; (ii) exposing the film; and (iii) developing the film exposed, by using an organic solvent-containing developer to form a negative pattern.. . ... Fujifilm Corporation

12/31/15 / #20150378136

Wide angle lens and imaging apparatus

A wide angle lens is constituted by, in order from the object side to the image side: a front group having a negative refractive power; an aperture stop; and a rear group having a positive refractive power. The front group includes, in order from the object side to the image side, a first meniscus lens having a negative refractive power, and a second meniscus lens having a negative refractive power. ... Fujifilm Corporation

12/31/15 / #20150378089

Backlight unit and liquid crystal display device

A backlight unit including a light-emitting element and a member that selectively reduces an amount of emitted light, and wherein the light-emitting element includes a light source and a wavelength conversion member, and the wavelength conversion member includes at least one fluorescent material, the light-emitting element has a property of emitting blue light, green light, and red light, and the blue light has an emission intensity peak with an emission center wavelength falling within a wavelength range of 430 nm to 480 nm, the green light has an emission intensity peak with an emission center wavelength falling within a wavelength range of 520 nm to 560 nm and a half width exceeding 50 nm, and the red light has an emission intensity peak with an emission center wavelength falling within a wavelength range of 600 nm to 680 nm and a half width exceeding 50 nm.. . ... Fujifilm Corporation

12/31/15 / #20150378073

Polarizing plate and image display device

A polarizing plate includes an outer protective film and a polarizer. The sum s of the product of the modulus of elasticity and the cube of the thickness in each layer is up to 150,000 pa·mm3, and the value obtained by dividing the sum s by the knoop hardness k of the outer protective film is 200 or more but up to 450. ... Fujifilm Corporation

12/31/15 / #20150378066

Optical lens, lens unit, imaging module, electronic device, optical lens production method, lens mold, and shape correction method for lens mold

An optical lens 11, which has a lens section with a refractive power, has concave marks 33, 35, 37, and 39 which are formed to be recessed on a surface of the lens section, in an effective optical lens surface which contributes to image forming of the lens section. A width of each of these concave marks 33, 35, 37, and 39 is equal to or greater than 0.05 μm and equal to or less than 14 μm, and a depth of recession of each concave mark is equal to or greater than 0.05 μm and equal to or less than 5 μm.. ... Fujifilm Corporation

12/31/15 / #20150378062

Method of manufacturing hard coat film, hard coat film, polarizing plate, and liquid crystal display device

There is provided a method of manufacturing a hard coat film having a hard coat layer on at least one side of a transparent support, the method comprising curing a hard coat layer forming composition containing (a) a compound having one alicyclic epoxy group and one ethylenically unsaturated double bond group in a molecule and having a molecular weight of 300 or less, (b) a compound having three or more ethylenically unsaturated double bond groups in a molecule, (c) a radical polymerization initiator, and (d) a cationic polymerization initiator in a specific amount.. . ... Fujifilm Corporation

12/31/15 / #20150378058

Optical member and its production method

A first light-shied-coating formation step that forms a light shield coating only in a part of an area of a transparent-substrate in which a light shield coating is to be formed, a step that deposits an optical thin film including, as its outermost layer, a layer to be hydrothermally treated, which will become a fine uneven pattern coating by being hydrothermally treated, in an area in which an antireflection coating is to be formed, a second light-shield-coating formation step that forms a light shield coating in all of the area in which the light shield coating is to be formed, but the light shield coating was not formed in the first light-shield-coating formation step, and a step that forms the fine uneven pattern coating in the area in which the antireflection coating is to be formed by hydrothermally treating the layer to be hydrothermally treated are performed in this order.. . ... Fujifilm Corporation

12/31/15 / #20150376466

Adhesive film and laminate for touch panel

An adhesive film includes an adhesive layer containing an adhesive; and a release film disposed on at least one surface of the adhesive layer, temperature dependence of a relative dielectric constant of the adhesive layer that is determined by a test for evaluating temperature dependence is equal to or less than 30%, and the adhesive contains an acryl-based adhesive. The adhesive film including the adhesive layer can inhibit the occurrence of malfunctioning of a capacitance-type touch panel in an environment of a wide temperature range from a low temperature to a high temperature.. ... Fujifilm Corporation

12/31/15 / #20150376440

Inkjet recording method, printed material, and ink set

An inkjet recording method comprising, in order, a step of applying an undercoat solution having a ph of no greater than six to a substrate, a discharge step of discharging an ink composition onto the substrate to which the undercoat solution has been applied, a drying step of drying the ink composition above the substrate by means of heat, and a curing step of curing the ink composition above the substrate by irradiation with actinic radiation, the ink composition comprising (component a) a polymer compound comprising a monomer unit (a-1) having a partial structure represented by formula (1) below, (component b) water, and (component c) a pigment.. . ... Fujifilm Corporation

12/31/15 / #20150376218

Method for manufacturing nitrogen-containing carbon alloy, nitrogen-containing carbon alloy, and fuel cell catalyst

Provided is a method for manufacturing a nitrogen-containing carbon alloy having a sufficiently high oxygen reduction reaction activity, a nitrogen-containing carbon alloy, and a fuel cell catalyst. The method for manufacturing a nitrogen-containing carbon alloy comprises sintering a precursor which contains a nitrogen-containing compound and an inorganic metal salt, the nitrogen-containing compound having at least one heteroaromatic ring and a conjugated heterocycle, and the conjugated heterocycle having 12 or larger number of ring-forming atoms.. ... Fujifilm Corporation

12/31/15 / #20150375543

High height ink jet printing

A system includes a print head including multiple nozzles formed in a bottom surface of the print head. The nozzles are configured to eject a liquid onto a substrate. ... Fujifilm Corporation

12/31/15 / #20150375541

Recording medium transporting device and inkjet recording device

In a recording medium transporting device, an inter-shaft distance between a printing barrel that rotates and transports with gripping an end portion of a recording medium inwardly from an outer peripheral surface thereof and a first transporting barrel juncturally connected with the printing barrel is set to be a distance shorter than a sum of a radius of the printing barrel and a radius of the first transporting barrel, and an inter-shaft distance between the first transporting barrel and a second transporting barrel juncturally connected with the first transporting barrel is set to be a sum of the radius of the first transporting barrel and a radius of the second transporting barrel, which can suppress distortion of the recording medium and enables the first transporting barrel and the second transporting barrel to grip the end portion of the recording medium on the outer peripheral surface thereof, allowing stable transportation.. . ... Fujifilm Corporation

12/31/15 / #20150375520

Abnormality sensing method for pressure sensor, and liquid discharge device

The liquid discharge device includes a supply path which guides a liquid accumulated in a liquid accumulating unit to a liquid ejection head, a supply pump which feeds a liquid to the liquid ejection head from the liquid accumulating unit through the supply path, a damper which has a liquid chamber and an air chamber sectioned via a flexible membrane, and a pressure sensor, a pressure value is acquired from the pressure sensor in a state where the air chamber is open to atmosphere, and whether or not there is abnormality in the pressure sensor is determined based on comparison between a hydraulic head pressure between the damper and the pressure sensor, and the pressure value.. . ... Fujifilm Corporation

12/31/15 / #20150375265

Unimorph-type ultrasound probe

A unimorph-type ultrasound probe has a plurality of piezoelectric element regions which extend in a minor axis direction and are arranged at a predetermined arrangement pitch in a major axis direction, a plurality of minute piezoelectric element portions are formed so as to be arranged in each piezoelectric element region, the size of the plurality of minute piezoelectric element portions is changed in the minor axis direction, the plurality of minute piezoelectric element portions are arranged such that the size of the piezoelectric element portions in both end portions in the minor axis direction becomes smaller than the size of the piezoelectric element portions in a central portion in the minor axis direction, and ultrasonic waves having different frequencies are radiated from the piezoelectric element portions having different sizes.. . ... Fujifilm Corporation

12/31/15 / #20150374900

Centrifugal separation container, centrifugal separation device, and centrifugal separation method using said container and device

A storage portion forming a storage space 10, includes an inclined inner wall portion 20 that is connected to a base portion so that the diameter of the inclined inner wall portion gradually decreases; a concave portion 22 is formed at a part of the inclined inner wall portion; and the concave portion 22 includes a concave portion side surface 22b that is connected to a concave portion bottom surface 22a. The concave portion 22 is formed at a position, where the concave portion crosses an interface s between the specimen centrifuged during rotation and air, in a radial direction with respect to the central axis; and the maximum width of the concave portion 22 in a circumferential direction around the central axis is included in a range of 2 mm to a length of 20% of the whole circumference.. ... Fujifilm Corporation

12/31/15 / #20150374339

Ultrasound diagnostic apparatus, signal processing method for ultrasound diagnostic apparatus, and recording medium

An object of the present invention is to provide an ultrasound diagnostic apparatus, a signal processing method, and a recording medium which are capable of eliminating a ghost signal with a small number of data when correcting element data by superimposing a plurality of element data, obtaining a high quality ultrasound image while preventing a decrease in the frame rate, and reducing the capacity of a memory. Information on a transmission frequency of an ultrasonic beam is acquired, and second element data is generated using a plurality of first element data on the basis of the acquired information on a transmission frequency.. ... Fujifilm Corporation

12/31/15 / #20150374263

Medical image processing device, method for operating the same, and endoscope system

First rgb image signals are inputted. Color difference signals cr and cb are calculated from the first rgb image signals. ... Fujifilm Corporation

12/24/15 / #20150373228

Signal conversion method and apparatus, program, and print system

. . . . . . Provided are a signal conversion method and apparatus, a recording medium storing non-transitory program, and a print system which can prevent a color reproduction gamut from being excessively narrowed while avoiding a print failure caused by excess color material. A signal conversion method for limiting the total amount of color materials used in a printing device that forms an image on a recording medium using a plurality of color materials includes determining a final output vector after the total amount of color materials used is limited for an input vector, on the basis of a plurality of input/output signal conversion processes based on different limit values of the total amount of color materials used and weight definition information in which weights applied to the conversion results of the plurality of input/output signal conversion processes are determined according to the input vector.. ... Fujifilm Corporation

12/24/15 / #20150372234

Method for producing organic semiconductor element

In the method for producing an organic semiconductor element having a semiconductor layer according to the present invention, an optical system for irradiating a laser beam with a wavelength of at least 4 μm and a donor substrate prepared by forming an organic semiconductor film on a surface of a supporting member having a laser beam transmittance of at least 50% are used; and the donor substrate and a substrate to be treated serving as a semiconductor element are opposite one another; the laser beam is irradiated from the supporting member side; the laser beam is scanned while modulating in accordance with the semiconductor layer to be formed; and the organic semiconductor film is transferred to the substrate to be treated so as to form the semiconductor layer.. . ... Fujifilm Corporation

12/24/15 / #20150372233

Process for forming organic semiconductor film

In the present invention, an organic semiconductor film is formed by using a cover member which is disposed on a substrate for forming the organic semiconductor film and forms a space relative to the substrate, filling the space between the cover member and the substrate with a solution, and drying the filled solution, wherein the cover member has a control surface on which an uppermost part most separated from the substrate and a descending part provided on both sides in the y-direction of the uppermost part so as to descend from the uppermost part toward the substrate are formed.. . ... Fujifilm Corporation

12/24/15 / #20150372037

Solid-state image sensor and its manufacturing method, curable composition for forming infrared cut-off filters, and camera module

A solid-state image sensor includes a semiconductor substrate, photoelectric conversion elements arranged on a light receiving surface side of the semiconductor substrate and making up pixels, and a filter layer disposed on a light incidence side of the photoelectric conversion elements so as to correspond to the photoelectric conversion elements. The filter layer includes at least red color filters, green color filters, blue color filters and infrared cut-off filters. ... Fujifilm Corporation

12/24/15 / #20150371419

Inspection data display control apparatus, method, and recording medium

Providing an inspection data obtaining unit that obtains inspection data of a plurality of inspection items obtained in time series and a display control unit that graph-displays the inspection data of each inspection item obtained by the inspection data obtaining unit, in which the display control unit attaches a data label only to a change point in a graph of each inspection item and displays.. . ... Fujifilm Corporation

12/24/15 / #20150370403

Electronic apparatus and method for operating thereof

A tablet terminal comprises a touch panel which functions as a display for displaying a screen on a front face of a main body, and a controller which detects a contact to a touch sensor using a contact detection signal which the touch sensor outputs and executes control assigned to a point where the contact is detected after the point where the contact is detected is changed to a non-contact state.. . ... Fujifilm Corporation

12/24/15 / #20150370379

Touch panel and resin composition for forming protective layer

A touch panel having an input region and an outside region positioned outside the input region includes at least: a substrate; detection electrodes disposed on the substrate corresponding to the input region; lead-out wirings which are disposed on the substrate corresponding to the outside region and are electrically connected to the detection electrodes; and a protective layer disposed on the substrate corresponding to the outside region so as to cover the lead-out wirings. The protective layer is formed by using an epoxy resin, and the lead-out wirings contain metal silver and gelatin. ... Fujifilm Corporation

12/24/15 / #20150370038

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is constituted by six lenses, including: a first lens having a positive refractive power and a convex surface toward the object side; a second lens having a negative refractive power and a concave surface toward the object side; a third lens having a positive refractive power; a fourth lens having a negative refractive power; a fifth lens having a positive refractive power and a convex surface toward the object side; and a sixth lens having a negative refractive power, and the first lens, the second lens, the third lens, the fourth lens, the fifth lens and the sixth lens are provided in this order from the object side. The imaging lens satisfies predetermined conditional formulas.. ... Fujifilm Corporation

12/24/15 / #20150370036

Sunlight-collecting reflective mirror

A reflecting mirror for solar radiation collection includes a film mirror and a frame-shaped support member adapted to support a peripheral edge of the film mirror. The film mirror has a film thickness of 0.10 to 0.30 mm, and the support member is in contact with the film mirror and has a curved face which is convexed outward in a horizontal direction with respect to an opening face of the support member, with the curved face having a radius of curvature of not less than 8 mm. ... Fujifilm Corporation

12/24/15 / #20150369983

Reflection film, optical member, and display

The present invention provides a reflection film, comprising a right circularly-polarized light reflection layer and a left circularly-polarized light reflection layer as circularly-polarized light reflection layers, each of the circularly-polarized light reflection layers consisting of a layer obtained by fixing a cholesteric liquid-crystalline phase, having a reflection wavelength at which a diffuse reflectance for non-polarized light becomes 50% or more in a wavelength region in which each of the circularly-polarized light reflection layers exhibits selective reflection, the reflection wavelength being in an infrared wavelength region, and the reflection film exhibiting a direct transmittance of non-polarized visible light of 50% or more and a haze value of 5% or less; and an optical member including the reflection film, which can be used as a handwriting input sheet. The optical member can be used by being stuck to the surface of a display.. ... Fujifilm Corporation

12/24/15 / #20150369979

Optical member and display including the optical member

The present invention provides an optical member including a reflection layer and an information presentation layer, the reflection layer comprising one or more circularly-polarized light reflection layers selected from the group consisting of a right circularly-polarized light reflection layer and a left circularly-polarized light reflection layer, the circularly-polarized light reflection layer consisting of a layer obtained by fixing a cholesteric liquid-crystalline phase, the reflection layer having a reflection wavelength at which a specular reflectance for non-polarized light is more than 20% in a wavelength region in which the circularly-polarized light reflection layer exhibits selective reflection, a diffuse reflectance for non-polarized light at the reflection wavelength less than 50%, the reflection wavelength being in an infrared wavelength region, and the information presentation layer having a pattern of a material that absorbs or reflects light of the reflection wavelength. The optical member can be used as a handwriting input sheet, which can be used by being stuck to the surface of a display.. ... Fujifilm Corporation

12/24/15 / #20150369974

Film mirror for solar radiation collection and method for producing same

A film mirror for solar radiation collection includes at least a protective layer, a silver reflective layer and a resin substrate in this order from a light incident side and has a corrosion inhibitor present at either or both of a surface and a surface layer of the silver reflective layer on the protective layer side, with the content of the corrosion inhibitor being 0.1 to 10 mg/m2. The film mirror for solar radiation collection is excellent in adhesion of the protective layer and in lightfastness as well.. ... Fujifilm Corporation

12/24/15 / #20150369931

Radiation detecting apparatus

A radiation detecting apparatus includes a radiation detector including a scintillator for converting radiation that has passed through a subject into visible light, and a substantially rectangular shaped photoelectric transducer board for converting the visible light into radiographic image information, and a casing housing the radiation detector therein. The casing is of a substantially rectangular shape and includes an upper plate, a lower plate, and a frame interconnecting the upper plate and the lower plate. ... Fujifilm Corporation

12/24/15 / #20150368491

Inkjet ink composition, inkjet recording method, ink set, decorative sheet, decorative sheet molded product, process for producing in-mold molded article, and in-mold molded article

An inkjet ink composition of the present invention that comprises (component a) a maleimide-styrene copolymer having an ammonium salt structure, (component b) an n-vinyl compound, (component c) a colorant, and (component d) a photopolymerization initiator.. . ... Fujifilm Corporation

12/24/15 / #20150366444

Endoscope system, light source device, operation method for endoscope system, and operation method for light source device

An endoscope system includes a light source unit, a band limiting unit, a light source control unit, an imaging sensor, an imaging control unit, and an oxygen saturation image generation unit. The light source unit includes a v-led that emits violet light, a b-led that emits blue light, a g-led that emits green light, and an r-led that emits red light. ... Fujifilm Corporation

12/17/15 / #20150365661

Image capturing apparatus, calibration method, and non-transitory computer-readable medium

. . . . . . An image capturing apparatus according to an aspect of the present invention includes an image capturing unit, a display unit that displays an imaged picture imaged by the image capturing unit and a guide linearly shaped along a sagittal direction or a tangential direction in the imaged picture, the guide assisting imaging of a calibration image used for calibration in a point image restoration process, and a parameter calculation unit that calculates a parameter for the point image restoration process on the basis of the calibration image imaged by the image capturing unit with assistance from the guide.. . ... Fujifilm Corporation

12/17/15 / #20150365548

Display processor, display processing method and ordering apparatus

An ordering apparatus for printing has a touchscreen panel, where a user screen view is displayed. A list display area and a specific display area are defined in the user screen view. ... Fujifilm Corporation

12/17/15 / #20150365547

Image processing device, image processing method, and storage medium storing image processing program

A print order reception apparatus displays one of an image selection screen and an editing content changing screen. In the image selection screen, a list display area for showing a plurality of thumbnail images and a finished print display area for showing target images, which are selected in the list display area, in a finished state are displayed side by side. ... Fujifilm Corporation

12/17/15 / #20150364686

Method for forming organic semiconductor film

A method for forming an organic semiconductor film includes: forming a solution film by applying a solution containing an organic semiconductor material and a solvent to at least a part of a substrate; and drying the solution film by irradiating at least a part of the solution film with electromagnetic waves with a wavelength of at least 8 μm and an energy density of from 0.1 to 10 j/cm2 on the surface of the solution film before the solution film dries. An organic semiconductor film having good crystallinity can be formed by the method.. ... Fujifilm Corporation

12/17/15 / #20150364674

Oxide particles, piezoelectric element, and method for producing oxide particles

The present invention provides oxide particles having a compositional formula of pb(zrxti1-x)o3, wherein x is 0.46≦x≦0.6; wherein a size of the particle is from 0.5 to 10 μm; a porosity of a surface of the particle is 20% or less; and a shape of the particle is any one of a cube, a rectangular parallelepiped, or a truncated octahedron.. . ... Fujifilm Corporation

12/17/15 / #20150364153

Method for manufacturing optical information recording medium

Method for manufacturing an optical information recording medium includes: preparing a substrate material where a first guide groove has been formed on a first side of the substrate material; forming a second guide groove by applying an energy-curable resin material between a second side of the substrate material opposite to the first side and a stamper and subsequently curing the energy-curable resin material to form a substrate; providing at least one recording layer and a cover layer on a first side of the substrate where the first guide groove has been formed, while holding the substrate with the stamper left unremoved from the substrate to protect the second guide groove; and exposing the second guide groove by removing the stamper and providing at least one recording layer and a cover layer on a second side of the substrate where the second guide groove has been formed.. . ... Fujifilm Corporation

12/17/15 / #20150363926

Radiation image processing device and method, and radiographic imaging system

A console structure in an x-ray imaging system performs image processing of plural radiation images formed by an x-ray imaging apparatus having an active pixel area with pixels for detecting a radiation image of a body. The plural radiation images are formed by imaging one object in the body with a time interval. ... Fujifilm Corporation

12/17/15 / #20150363055

Information display unit and method of multi-level type, ordering apparatus and computer-executable program

An information display unit includes a first display control device for displaying a plurality of first button portions of higher level items of a first menu level in a button display area. A selective detector detects a selected first button portion selected among the plural first button portions. ... Fujifilm Corporation

12/17/15 / #20150360498

Infrared sensitive color-forming composition, infrared curable color-forming composition, lithographic printing plate precursor and plate making method

The invention is directed to an infrared sensitive color-forming composition containing a compound having an infrared absorbing skeleton and a thermochromic skeleton in a molecule thereof wherein the infrared absorbing skeleton and the thermochromic skeleton are connected with a covalent bond or an ionic bond and a binder; an infrared curable color-forming composition wherein the infrared sensitive color-forming composition further contains a radical initiator and a polymerizable compound; a lithographic printing plate precursor having an image-recording layer containing the infrared curable color-forming composition on a support; a plate making method including imagewise exposing the lithographic printing plate precursor and conducting on-press development processing by supplying printing ink and dampening water on a printing machine to remove a non-image area; a compound represented by the formula (7) as defined herein; and a compound represented by the formula (8) as defined herein.. . ... Fujifilm Corporation

12/17/15 / #20150360483

Image forming device

The present invention provides an image forming device having: a conveying mechanism that pulls and conveys a recording medium onto which liquid drops have been applied; and a suction plate that is provided with a plurality of suction holes that suck the recording medium conveyed by the conveying mechanism, and at which, when the suction holes are projected in a conveying direction of the recording medium, the suction holes are disposed such that any one of the suction holes exists in a direction orthogonal to the conveying direction of the recording medium, and the suction holes are disposed so as to overlap one another.. . ... Fujifilm Corporation

12/17/15 / #20150360464

Liquid ejection device and dummy jet method

A liquid ejection device includes an ink jet head in which a plurality of nozzle portions are arranged in a matrix; a plurality of pressurizing elements that generate an ejection force; and a driving voltage supply unit that supplies a driving voltage to the pressurizing elements. In the device, the ink jet head is provided with supply flow paths, the nozzle portions which are supplied with the liquid from the same the supply flow path are divided into two or more groups, the driving voltage supply unit supplies an ejection driving voltage for ejecting the liquid to each of the groups when a dummy jet is performed, and during a period of time when the dummy jet is performed for one group, the driving voltage supply unit supplies a non-ejection driving voltage for preventing the liquid from being ejected to the other groups.. ... Fujifilm Corporation

12/17/15 / #20150359421

Gas supply and liquid supply apparatus

A gas supply and liquid supply apparatus includes a first fluid pipe which is provided in an endoscope, the first fluid pipe supplying a first fluid, a second fluid pipe which is provided in the endoscope together with the first fluid pipe, the second fluid pipe supplying a second fluid, and a confluence pipe which is provided in a substantially cylindrical distal end part of an insertion part of the endoscope. The confluence pipe includes a first communication part which is communicated with the first fluid pipe and has a bent shape, a second communication part which is communicated with the second fluid pipe and has a bent shape, and a confluence part in which the first communication part and the second communication part are brought together.. ... Fujifilm Corporation

12/10/15 / #20150358514

Display device

. . . . . . . . . . . . . . . . . . The present invention provides a display device which has a display unit on a main body, comprising a cover member that can be deformed into a first shape for covering the display unit and a second shape for forming a grip in order to solve the problems in the conventional cameras. The problem is such that the size of the camera becomes large by the size of the grip, which impairs portability of the camera because the conventional camera provides a fixed grip on the camera body on which a display unit with a large screen is mounted. ... Fujifilm Corporation

12/10/15 / #20150356905

Liquid crystal display device

A liquid crystal display device where the luminance control unit determines a coefficient ku, where ku<1, as the coefficient and repeatedly multiplies each of the luminance set values by the coefficient ku until the first integrated value is within the range of the first threshold value in a case where the first integrated value is larger than the range of the first threshold value, and the luminance control unit determines a coefficient kl, where kl>1, as the coefficient and repeatedly multiplies each of the luminance set values by the coefficient kl until the first integrated value is within the range of the first threshold value in a case where the first integrated value is smaller than the range of the first threshold value.. . ... Fujifilm Corporation

12/10/15 / #20150356739

Image assessment device, capturing device, 3d measuring device, image assessment method, and non-transitory computer-readable medium

The present invention provides an image assessment device capable of accurately and promptly assessing an image pair used for 3d measurement from plural captured images. An image assessment device according to the invention includes first captured image selection device, first captured image information acquisition device, object distance to-be-measured acquisition device, object position to-be-measured calculation device, second captured image selection device, second captured image information acquisition device, imaging range calculation device, and assessment device that determines whether or not a calculated object position to be measured is within a calculated imaging range, and assesses that a first captured image and a second captured image are of an image pair if determining that the calculated object position to be measured is within the calculated imaging range.. ... Fujifilm Corporation

12/10/15 / #20150356732

Image display device and method

Provided is a technique which can easily identify a plurality of radiological images when the plurality of radiological images are displayed so as to be switched. A display control unit displays a plurality of radiological images, such as the latest breast image and a past breast image, on a display unit so as to be switched. ... Fujifilm Corporation

12/10/15 / #20150356713

Image processing device, imaging device, image processing method, and non-transitory computer readable medium

A device includes: an image acquisition device acquiring a taken image in which a subject is imaged; a smoothing device generating a smoothed image by smoothing the taken image; a noise extraction device extracting a difference noise component from a difference between the taken image and the smoothed image; a noise addition device adding the difference noise component to the smoothed taken image; a map acquisition device acquiring a blurring strength map that represents a distribution of blurring strengths for the taken image; and an image combining device combining the taken image with the smoothed image on the basis of the blurring strength map, and generating an output image.. . ... Fujifilm Corporation

12/10/15 / #20150356499

System and method for providing products from multiple websites

A system and method that combines content with one or more canvas products to provide finished products for dissemination to end customers is provided. More specifically, a system and method are provided to enable a content provider to select one or more canvas products to which content would be applied, whereby the content provider may then provide web links on any of a multitude of locations to redirect an end customer to a canvas product center and/or fulfillment center to acquire finished products having content thereon. ... Fujifilm Corporation

12/10/15 / #20150355799

Electronic album apparatus and method of controlling operation of same

An electronic album is created taking into consideration the intentions of the user regarding electronic album creation. Face images are extracted from among a number of images for an electronic album and the face images are displayed on a display screen. ... Fujifilm Corporation

12/10/15 / #20150355797

Electronic equipment, display control method and storage medium

An electronic book reader includes a touchscreen display device disposed on a front surface of a housing. A storage medium stores image sequence information of plural images of a predetermined sequence. ... Fujifilm Corporation

12/10/15 / #20150355754

Capacitance touch panel

A capacitance touch panel of the invention includes a display, a lower adhesive layer, a capacitance touch panel sensor, an upper adhesive layer and a protective substrate, which are formed in this order. Relative permittivity a in the upper adhesive layer and relative permittivity b in the lower adhesive layer satisfy expression (1): [relative permittivity a≧relative permittivity b . ... Fujifilm Corporation

12/10/15 / #20150355684

Electronic equipment with display device

Portable terminal equipment as a mobile telephone includes a display device disposed with a front surface of a housing. A first touch sensor is provided in the display device. ... Fujifilm Corporation

12/10/15 / #20150355541

Actinic-ray- or radiation-sensitive resin composition, actinic-ray- or radiation-sensitive film and pattern forming method

An actinic-ray- or radiation-sensitive resin composition includes (a) a resin containing an acid-decomposable repeating unit and having a polarity that is changed when the resin is acted on by an acid, and (b) a compound that is configured to produce an acid when exposed to actinic rays or radiation. The acid produced by the compound (b) exhibits a log p value of 3.0 or below and has a molecular weight of 430 or greater.. ... Fujifilm Corporation

12/10/15 / #20150355397

Optical film, polarizing plate, and liquid crystal display device

The objective of the present invention is to provide an optical film which shows an improved developability of optical characteristics per unit thickness and concurrently shows excellent moisture dependence and optical stability under hygrothermal conditions, and to provide a polarizing plate and a liquid crystal display device using such optical film. The present invention provides an optical film including a cellulose acylate whose degree of substitution of acyl group is from 2.0 to 2.6, satisfying formula 1 and formula 2 below, and having a thickness of 40 μm or thinner; formula 1: Δrth(rh)/rth(550)≦0.12 and formula 2: Δrth(60° c.90% 1d)/rth(550)≦0.05, in the formulae, Δrth(rh)=rth(30%)−rth(80%) and Δrth(60° c.90% 1d)=rth(60° c.90% 1d)−rth(initial).. ... Fujifilm Corporation

12/10/15 / #20150355175

Test substance measurement kit and test substance measurement method

To provide a test substance measurement method and a test substance measurement kit adapted to improve the accuracy of the measurement of a test substance. A test substance measurement kit includes: fluorescent particles which are modified with a first binding substance having specific bindability to a test substance; non-fluorescent particles which are modified with a second binding substance having no specific bindability to the test substance; and a substrate on which a first metal film to which a third binding substance having specific bindability to the test substance is fixed, and a second metal film to which a fourth binding substance having no bindability to the test substance, but having bindability to the first binding substance is fixed, and which has a smaller thickness than the first metal film are formed.. ... Fujifilm Corporation

12/10/15 / #20150355021

Ultraviolet-sensitive sheet, method for manufacturing ultraviolet-sensing sheet, and method for sensing ultraviolet

Provided an ultraviolet-sensing sheet that facilitates measurement of ultraviolet irradiance over a wide area, that is suitable in ultraviolet irradiance in a range from 1 to 1,000 mj/cm2, a method for manufacturing such an ultraviolet-sensing sheet, and a method for sensing ultraviolet. The ultraviolet-sensing sheet has a change in reflection density Δd1 of 0.2 or more over a range of cumulative illuminance 1 mj/cm2 or more and less than 10 mj/cm2, a change in reflection density Δd2 of 0.2 or more over a range of cumulative illuminance 10 mj/cm2 or more and less than 100 mj/cm2, and a change in reflection density Δd3 of 0.2 or more over a range of cumulative illuminance 100 mj/cm2 or more and 1,000 mj/cm2 or less, as measured at a wavelength of 365 nm when the ultraviolet-sensing sheet is irradiated with a high-pressure mercury lamp.. ... Fujifilm Corporation

12/10/15 / #20150353751

Inkjet ink composition, inkjet recording method, printed material, and process for producing molded printed material

An inkjet ink composition of the present invention that includes (component a) n-vinylcaprolactam, (component b) a monofunctional acrylate having an aromatic ring, (component c) a monofunctional acrylate having an aliphatic hydrocarbon ring, (component d) a polyether-modified silicone compound having a (meth)acrylate group, (component e) an acrylic resin having a glass transition temperature (tg) of 20° c. To 100° c., (component f) a pigment, and (component g) a photopolymerization initiator, wherein the total content of component a to component c is at least 90 mass % of the total mass of polymerizable compounds, excluding component d, in the ink composition, and a content of component e is 1 to 8 mass % relative to the total mass of the ink composition.. ... Fujifilm Corporation

12/10/15 / #20150353745

Dye blocking printing ink system for printing on polyester blended fabrics

The present disclosure relates to a dye blocking printing ink to stop dye migration from fabric to print, particularly in polyester blended and 100% polyester fabrics. The dye blocking printing ink of present disclosure comprises a resin devoid of vinyl chloride moiety, a plasticizer, a wetting agent and a formaldehyde free discharge agent. ... Fujifilm Corporation

12/10/15 / #20150353721

Polymer functional film and method for producing same

The present invention provide a polymer functional film having a structure represented by the following formula (i) and having a water content of 20% by mass to 50% by mass, and a method for producing the same:. . ... Fujifilm Corporation

12/10/15 / #20150353320

Reel and reel component parts

A reel including a hub that is formed from a resin and that has a bottomed circular cylindrical shape open at an upper end portion side, a lower flange that is provided at a lower end portion side of the hub and that is integrally formed to the hub, a ring shaped upper flange that faces toward the lower flange, and a weld portion where a lower face of the upper flange is joined to an upper end face of the hub. The weld portion is formed such that there is at least a region present where there are plural weld portions disposed side-by-side in the radial direction within any selected range of the hub having a central angle of 90 degrees in plan view.. ... Fujifilm Corporation

12/10/15 / #20150352252

Cell construct for cell transplantation, biocompatible polymer block, and method for producing the same

It is an object of the present invention to provide a cell construct for cell transplantation that does not contain a substance having cytotoxicity, such as glutaraldehyde, and suppresses the necrosis of the transplanted cells in the construct (namely, having a high cell survival rate). The present invention provides a cell construct for cell transplantation comprising biocompatible polymer blocks that do not contain glutaraldehyde and at least one type of cells, wherein a plurality of biocompatible polymer blocks are disposed in gaps among a plurality of cells, and wherein the biocompatible polymer blocks have a tap density of 10 mg/cm3 or more and 500 mg/cm3 or less, or the value of the square root of the cross-sectional area/boundary length in the two-dimensional sectional image of the polymer block is 0.01 or more and 0.13 or less.. ... Fujifilm Corporation

12/10/15 / #20150351727

Systems and methods for cooling ultrasound transducers

Systems and methods of transmitting heat away from an ultrasound probe are disclosed within. In one embodiment, a handheld ultrasound probe includes a transducer, electronics configured to drive the transducer, and a housing surrounding the transducer assembly and the electronics. ... Fujifilm Corporation

12/10/15 / #20150351717

Ultrasound diagnostic apparatus, method of transmitting and receiving ultrasonic wave, and program for transmitting and receiving ultrasonic wave

An ultrasound diagnostic apparatus includes plural ultrasound transducers which perform transmission and reception of ultrasonic waves toward a target site of a subject containing a puncture needle. A method of transmitting and receiving an ultrasonic wave uses the ultrasound transducers. ... Fujifilm Corporation

12/03/15 / #20150349290

Functional film

. . . . . . A functional film has a support which has a value of retardation of equal to or less than 50 nm; a protective inorganic film which is formed on the support; one or more combinations, each of which is composed of an organic film as an underlayer and an inorganic film, formed on the protective inorganic film; and a sealant layer which adheres onto the inorganic film as an uppermost layer by an adhesive layer, has a value of retardation of equal to or less than 300 nm, and has a glass transition temperature lower than that of the support.. . ... Fujifilm Corporation

12/03/15 / #20150348293

Image display device, image display method, medical image diagnostic device, medical image diagnostic method, medical image diagnostic system, data preparation device, data preparation method, and non-transitory recording medium

In the present invention, in a case where a display unit is capable of displaying either multiple tomographic images or at least one plain image of a subject, a display control unit switches the display on the display unit to the display of tomographic images in sequence or to the display of a plain image.. . ... Fujifilm Corporation

12/03/15 / #20150347059

Image defect detection device, image defect detection method, and imaging unit

Disclosed are an image defect detection device, method and an imaging unit capable of reliably detecting image defect, such as stripe unevenness or scratches, even if a comparatively inexpensive and low resolution imaging unit is used. An image reading unit has a plurality of read pixels arranged in a second direction intersecting a first direction and reads an image recorded on a recording medium by a single-pass recording head, which is relatively moved in the first direction. ... Fujifilm Corporation

12/03/15 / #20150346585

Imaging apparatus and focusing control method

Provided is an imaging apparatus capable of performing af with a high precision regardless of an object while realizing increase in af speed. When there is an af instruction, photographing is performed while a focus lens is moved. ... Fujifilm Corporation

12/03/15 / #20150346465

Rear attachment lens

A rear attachment lens changes a focal-length of an entire lens-system, in which the rear attachment lens has been attached to a main-lens, to a longer focal-length-side than a focal-length of the main-lens by being attached to an image-side of the main-lens. The rear attachment lens consists essentially of a first-lens-group and a second-lens-group in this order from an object-side. ... Fujifilm Corporation

12/03/15 / #20150346409

Optical film, polarizing plate and liquid crystal display device

An optical film having a thickness of from 10 to 45 μm and containing a cellulose ester, a polyester having a recurring unit represented by the formula 1a and having a blocked terminal, and a durability improving agent for a polarizer wherein re and rth are from −5 to 5 nm at a wavelength of 590 nm can be used as an polarizing plate protective film and is capable of ensuring the durability of the polarizer under a high temperature and high humidity environment. X represents an acyclic divalent linking group, r represents an alkyl, alkenyl, alkynyl or aryl group, and m represents an integer of from 0 to 4.. ... Fujifilm Corporation

12/03/15 / #20150346404

Infrared ray absorbing composition or infrared ray absorbing composition kit, infrared ray cut filter using the same, method for producing the infrared ray cut filter, camera module, and method for producing the camera module

An infrared ray absorbing composition kit comprises: a composition containing a copper compound or pigment having a maximum absorption wavelength in the wavelength range of 700 nm to 1000 nm; and a composition containing a metal oxide having a maximum absorption wavelength in the wavelength range of 800 nm to 2000 nm.. . ... Fujifilm Corporation

12/03/15 / #20150346390

Optical film, polarizing plate and liquid crystal display device

An optical film having a thickness of from 10 to 45 μm and containing a cellulose ester and a polyester having a recurring unit represented by the formula 1 and having a terminal blocked with an alicyclic structure wherein re and rth are from −5 to 5 nm at a wavelength of 590 nm can be used as an polarizing plate protective film and is capable of ensuring excellent film surface smoothness and the durability of a polarizer under a high temperature and high humidity environment. X represents an acyclic divalent linking group, r represents an alkyl, alkenyl, alkynyl or aryl group, and m represents an integer of from 0 to 4.. ... Fujifilm Corporation

12/03/15 / #20150345014

Barrier laminate and gas barrier film

A barrier laminate includes at least one organic layer and at least one inorganic layer, the organic layer is a layer formed of a polymerizable composition including a polymerizable compound, and the polymerizable compound has a condensed polycyclic hydrocarbon structure. A gas barrier film includes a polymer, in which the barrier laminate is provided on a support and the support includes a cyclic olefin as a repeating unit structure.. ... Fujifilm Corporation

12/03/15 / #20150344782

Polymerizable liquid crystal compound, liquid crystal composition, polymer material and method for manufacturing the same, and film

Provided is a liquid crystal composition which is easily synthesized and highly suppress crystallization thereof. The liquid crystal composition includes at least one compound represented by formula (1), wherein z1 represents —co—, —o—co— or single bond, and z2 represents —co— or —co—ch═ch—, at least one compound represented by formula (2) not having (meth)acrylate group, wherein z3 represents —co— or —ch═ch—co—, and z4 represents —co— or —co—ch═ch—, and at least one compound represented by formula (3), wherein z5 represents —co—, —o—co— or single bond, and z6 represents —co—, —co—o— or single bond.. ... Fujifilm Corporation

12/03/15 / #20150344711

Ink composition, inkjet recording method, printed matter, and high-molecular-weight polymerization initiator

An ink composition contains (component a) a high-molecular-weight polymerization initiator having a weight-average molecular weight of equal to or greater than 1,000, (component b) a polymerizable compound, and (component c) a colorant, in which the component a has an acylphosphine oxide structure, and the acylphosphine oxide structure is linked to a main chain or a core of the component a on the side of an acyl group thereof.. . ... Fujifilm Corporation

12/03/15 / #20150344709

Radiation-curable ink composition, ink set, inkjet recording method, decorative sheet, decorative sheet molded product, process for producing in-mold molded article, and in-mold molded article

A radiation-curable ink composition comprises a polymerizable compound as component a; a photopolymerization initiator as component b; and two or more types of surfactants as component c, wherein component c comprises at least a surfactant that has a polymerizable group and a surfactant that does not have a polymerizable group, and the mass ratio of a content c1 of the surfactant that has a polymerizable group and a content c2 of the surfactant that does not have a polymerizable group is c1:c2=35:1 to 1:10.. . ... Fujifilm Corporation

12/03/15 / #20150344249

Paper transporting device and image forming device

When a distal end of a paper is gripped by a gripper of a chain gripper and transported, the paper is transported while being in sliding contact with a guide surface of a guide plate. On the guide surface of the guide plate, a groove is formed along a traveling route of the gripper, and by a claw member entering the groove, a height of the distal end of the paper gripped by the gripper and a height of the guide surface are matched.. ... Fujifilm Corporation

12/03/15 / #20150343820

Method for measuring amount of positional deviation and image-recording device

Dot patterns are recorded on a recording medium at intervals determined in advance in a second direction using first and second head modules while relatively moving a recording head and the recording medium in the second direction. The dot patterns are optically read, and a density profile representing change in density in the second direction of a read image of the dot patterns is calculated. ... Fujifilm Corporation

12/03/15 / #20150343389

Curable compositions and membranes

A composite membrane comprising: a) a porous support; b) a gutter layer, a portion of which is present within the support and a portion of which is outside of the support; and c) a discriminating layer on the gutter layer; wherein: (i) the portion of the gutter layer outside of the support has an average thickness (gle) of 10 nm to 900 nm; and (ii) the portion of the gutter layer present within the support has an average thickness (gli) of 10% to 350% of gle.. . ... Fujifilm Corporation

11/26/15 / #20150342034

Conductive film, display device provided with same, and method for evaluating conductive film

The conductive film includes a transparent substrate and a conductive portion having a wiring pattern, in which when the wiring pattern is observed from at least one visual point, with respect to frequencies and intensities of moires which are calculated respectively from peak frequencies and peak intensities of predetermined data_and peak frequencies and peak intensities of another predetermined data, an evaluation index of moire, which is calculated from evaluation values of moires obtained by applying visual response characteristics of a human being to the intensities of the moires according to an observation distance at the frequencies of the respective moires that are equal to or lower than the maximum frequency of moire specified according to display resolution of the display unit, is equal to or less than a predetermined value.. . ... Fujifilm Corporation

11/26/15 / #20150341462

System and method for providing caching and pre-fetch of assets/media

A system and method for routing and delivering pre-fetched assets/media, such as a digital image, is provided. The present invention is directed to a system that allows for two digital images to be pre-fetched or otherwise transferred concurrently from two separate source devices to virtually expand the bandwidth and increase the efficiency of the transfer. ... Fujifilm Corporation

11/26/15 / #20150340625

Organic thin film transistor, organic semiconductor thin film, and organic semiconductor material

An organic thin film transistor containing a compound represented by one of the following formulae in a semiconductor active layer has a high carrier mobility and a small change in the threshold voltage after repeated driving. X represents s or o, z represents a substituent having a length of 3.7 Å or less, and at least one of r1 to r8 represents -l-r wherein l represents alkylene, etc., and r represents alkyl, etc.. ... Fujifilm Corporation

11/26/15 / #20150340624

Organic thin film transistor, organic semiconductor thin film, and organic semiconductor material

An organic thin film transistor containing a compound represented by one of the following formulae in a semiconductor active layer has a high carrier mobility and a small change in the threshold voltage after repeated driving. X represents s or o, and at least one of r1 to r6 represents -l-r wherein l represents alkylene, etc., and r represents alkyl, etc.. ... Fujifilm Corporation

11/26/15 / #20150339447

Medical assistance device, operation method of medical assistance device, non-transitory computer-readable recording medium, and medical assistance system

There is provided a medical assistance device that can provide optimal diagnostic assistance information within a range of display items viewable by a doctor in medical information and can provide a development environment in which it is easy to efficiently improve a diagnostic assistance program to provide diagnostic assistance information. A medical assistance server includes an association setting unit and a parameter output unit. ... Fujifilm Corporation

11/26/15 / #20150338743

Pattern forming method, method for manufacturing electronic device using same, and electronic device

There is provided a pattern forming method comprising a step of forming a resist film from an actinic ray-sensitive or radiation-sensitive resin composition containing a resin capable of increasing the polarity by an action of an acid to decrease the solubility in an organic solvent-containing developer and a compound capable of decomposing upon irradiation with an actinic ray or radiation to generate an acid, a step of forming, on the resist film, a protective film from a protective film composition, a step of exposing the resist film having a protective film to an electron beam or an extreme-ultraviolet ray, and a step of developing the resist film by using the organic solvent-containing developer.. . ... Fujifilm Corporation

11/26/15 / #20150338736

Actinic-ray- or radiation-sensitive resin composition, actinic-ray- or radiation-sensitive film and method of forming pattern

Provided is an actinic-ray- or radiation-sensitive resin composition including a resin (a) and any of compounds (b) of general formula (i) below. (in general formula (i), rf represents a fluorine atom or a monovalent organic group containing at least one fluorine atom; r1 represents a hydrogen atom or a monovalent substituent containing no fluorine atom; x1 represents a monovalent organic group having at least two carbon atoms, or a methyl group in which a substituent other than a fluorine atom is optionally introduced, provided that x1 may be bonded to r1 to thereby form a ring; and z represents a moiety that when exposed to actinic rays or radiation, is converted to a sulfonic acid group, an imidic acid group or a methide acid group.). ... Fujifilm Corporation

11/26/15 / #20150338733

Colored photo-sensitive composition, color filter, and method for manufacturing color filter

Provided is a colored photo-sensitive composition having a high sensitivity and a good developablity, even if the ratio of content of a pigment, relative to the total solids of the colored photo-sensitive composition, is 20% by mass or more. The colored photo-sensitive composition includes (a) a resin which is increased, by action of an acid, in solubility into an alkali developing solution; (b) a pigment; (c) a compound which produces an acid upon irradiated by active light or radial ray; and (d) a solvent, wherein the ratio of content of the (b) pigment, relative to the total solids of the colored photo-sensitive composition, is 20% by mass or more.. ... Fujifilm Corporation

11/26/15 / #20150338732

Actinic-ray- or radiation-sensitive resin composition, actinic-ray- or radiation-sensitive film, pattern forming method, process for manufacturing electronic device and electronic device

An actinic-ray- or radiation-sensitive resin composition includes a compound (a) that is configured to produce an acid when exposed to actinic rays or radiation, and a resin (b). The compound (a) is expressed by general formula (1) or (2) below. ... Fujifilm Corporation

11/26/15 / #20150338624

Reflecting mirror for solar radiation collection

A reflecting mirror for solar radiation collection includes: a film mirror for solar radiation collection having a polygonal shape and including a resin substrate, a metallic reflective layer and a surface covering layer; and a support member having a frame shape and adapted to support a peripheral edge of the film mirror.. . ... Fujifilm Corporation

11/26/15 / #20150338615

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is constituted by six lenses, including: a first lens having a positive refractive power and a convex surface toward the object side; a second lens having a negative refractive power and a convex surface toward the object side; a third lens having a positive refractive power; a fourth lens having a positive refractive power; a fifth lens having a positive refractive power and a convex surface toward the object side; and a sixth lens having a negative refractive power, provided in this order from the object side. The imaging lens satisfies a predetermined conditional formula.. ... Fujifilm Corporation

11/26/15 / #20150338606

Image pickup device

An image pickup device includes a photographing optical system having a central optical system disposed at a central region and a circular optical system disposed at an outer portion of the central optical system which are arranged along the same optical axis, a directional sensor having plural pixels including two-dimensionally arranged photoelectric conversion elements, the directional sensor including plural pixels for selectively receiving light beams of light fluxes which are incident via the central optical system and the circular optical system by applying pupil division, an image readout device that acquires from the directional sensor each of an image signal representing a first image received via the central optical system and an image signal representing a second image received via the circular optical system.. . ... Fujifilm Corporation

11/26/15 / #20150336381

Ink jet recording apparatus and abnormality detection method of ejector

Provided are an ink jet recording apparatus and an abnormality detection method of an ejector which are capable of performing high-accuracy abnormality detection and suppressing the generation of excessive abnormality detection with respect to a required image quality. An ink jet recording apparatus (10) includes an ink jet head (20c, 20m, 20y, 20k) having a plurality of ejectors, a medium transport unit (22), a calculation unit (34) that calculates an index value relevant to a droplet ejection amount for each ejector on the basis of printing data, a threshold determination unit (40) that determines a threshold for ejection abnormality determination for each ejector in accordance with the index value, a threshold storage unit (44) that stores the threshold determined for each ejector, and an abnormality determination unit (54) that determines the presence or absence of ejection abnormality by comparing the threshold with a measurement amount for each ejector.. ... Fujifilm Corporation

11/26/15 / #20150336056

Complex for acid gas separation, module for acid gas separation, and method for manufacturing module for acid gas separation

A complex for acid gas separation includes an acid gas separation membrane, a permeated gas flow path member, and a sealing portion. The acid gas separation membrane includes a porous support with pores having an average pore diameter of 0.5 μm or less, and an acid gas separation layer disposed on the porous support. ... Fujifilm Corporation

11/26/15 / #20150335289

Photoacoustic measurement device and puncture needle

The invention provides a photoacoustic measurement device that can confirm the position of a puncture needle in a photoacoustic image even in the case where the puncture needle is stuck to a deep position from the surface of a subject. Further, the invention provides a puncture needle that is used for the photoacoustic image generating device. ... Fujifilm Corporation

11/26/15 / #20150335252

Photoacoustic measurement device, photoacoustic measurement method, and probe contact determination method

A photoacoustic measurement device 10 includes a probe 11 having a light emitting unit that emits measurement light l and a plurality of acoustic wave detection elements, a determination unit 28 that determines whether a state between the probe 11 and a subject m is a contact state or a non-contact state, and a light intensity control unit (for example, a switching control unit 36 and an intensity switching unit 37) that controls the intensity of the measurement light such that the measurement light has a first intensity or a second intensity higher than the first intensity, on the basis of the determination result of the determination unit 28. The determination unit 28 performs the determination on the basis of the status of a change in a plurality of photoacoustic signals detected by the plurality of acoustic wave detection elements.. ... Fujifilm Corporation

11/19/15 / #20150334359

Image processing device, image capture device, image processing method, and non-transitory computer-readable medium

. . An image processing device includes a demosaicing process device, a luminance system image data acquisition device that acquires luminance system image data as image data regarding the luminance, a point image restoration process execution device, an information acquisition device that acquires control information concerning execution of the point image restoration process on the basis of imaging information concerning an imaging condition of a subject, and a point image restoration process control device.. . ... Fujifilm Corporation

11/19/15 / #20150332636

Image display device and method

An image display method includes the steps of: acquiring a third image formed by applying dynamic range extension processing to a first image and a second image photographed with low sensitivity or low exposure with respect to the first image, or a fourth image without dynamic range extension processing; displaying the acquired image in a transmissive type display panel; and making backlight luminance of a segment corresponding to a high luminance portion in the third image higher than backlight luminance of a segment corresponding to a low luminance portion when the acquired image is determined to be the third image.. . ... Fujifilm Corporation

11/19/15 / #20150331566

Electronic album creating apparatus and method of producing electronic album

A family electronic album is created. Representative face images of a family are displayed. ... Fujifilm Corporation

11/19/15 / #20150331314

Pattern forming method, compound used therein, actinic ray-sensitive or radiation-sensitive resin composition, resist film, manufacturing method of electronic device, and electronic device

There is provided an actinic ray-sensitive or radiation-sensitive resin composition comprising: (a) a resin having a group capable of decomposing by an action of an acid to produce a polar group, (c1) a compound containing a group capable of generating a first acidic functional group upon irradiation with an actinic ray or radiation and a group capable of generating a second acidic functional group different from the first acidic functional group upon irradiation with an actinic ray or radiation, and (c2) at least one compound containing two or more groups selected from the group consisting of the groups capable of generating the structures represented by the specific formulae upon irradiation with an actinic ray or radiation.. . ... Fujifilm Corporation

11/19/15 / #20150331282

Liquid crystal display device

A liquid crystal display device has a light source unit and a liquid crystal cell sandwiched by two polarizing plates. The light emitted by the light source unit has separated peaks in each of blue, green and red wavelength ranges. ... Fujifilm Corporation

11/19/15 / #20150331157

Sheet for illumination, printed matter for illumination, method of producing printed matter for illumination, and illumination signboard

A sheet for illumination including a support, a mat layer which is arranged on one surface of the support, and an easily-adhesive layer which is arranged on the other surface of the support, in which a transmission value in percentage of image clarity in comb teeth with an interval of 2 mm and an image clarity value in percentage of reflection at 60° in comb teeth with an interval of 2 mm when an angle between a traveling direction of light and a normal of a sheet is set to be 60° satisfy (transmission value in percentage of image clarity)/(image clarity value in percentage of reflection at 60°)≧2, suppresses reflection of external light without degrading sharpness of a printed image.. . ... Fujifilm Corporation

11/19/15 / #20150331151

Optical film, method of manufacturing the same, polarizing plate and liquid crystal display device

There is provided an optical film comprising a layer formed on a base film by curing a curable composition containing the specific component (a) in an amount of 50 to 99% by mass and the specific component (b) in an amount of 1 to 50% by mass, based on the total solid content of the curable composition when the total solid content of the curable composition is set to 100% by mass.. . ... Fujifilm Corporation

11/19/15 / #20150330785

Angular velocity sensor and manufacturing method therefor

One or more vibration plate layers of a diaphragm part are formed by a thin film forming technique. When a resonance frequency in a resonance vibration mode calculated from dimensions of a structure of an angular velocity sensor and an elastic parameter of a material thereof is defined as f kilohertz, a mass of a weight part is defined as m milligrams, a circumference of the diaphragm part is defined as r meters, a stress applied to a piezoelectric layer is defined as σp pascals, a thickness thereof is defined as tp meters, a stress applied to an n-th layer from the weight part in a vibration plate portion constituted by a plurality of layers including a lower electrode and the vibration plate layers is defined as τn pascals, and a thickness thereof is defined as tn meters (where n is a natural number), teff expressed by teff=r(σptp+Σσntn)/m satisfies {(−0.36f2+210)/33}≦teff≦{(0.44f2+210)/33}.. ... Fujifilm Corporation

11/19/15 / #20150330603

Wavelength conversion member, backlight unit, and liquid crystal display device

An aspect of the present invention relates to a wavelength conversion member, which comprises a wavelength conversion layer, wherein the wavelength conversion layer comprises at least one quantum dot which has a property of being excited with exciting light to emit fluorescence, and at least one oxygen permeability coefficient-reducing agent, an oxygen permeability coefficient per 1 mm thickness of the wavelength conversion layer is less than 150.0 cm3/m2/day/atm, and the oxygen permeability coefficient-reducing agent is a compound which exhibits an oxygen permeability coefficient-reducing capability of reducing the oxygen permeability coefficient per 1 mm thickness of the wavelength conversion layer by equal to or more than 30% per 10 parts by weight of the oxygen permeability coefficient-reducing agent relative to 100 parts by weight of the wavelength conversion layer except for the oxygen permeability coefficient-reducing agent.. . ... Fujifilm Corporation

11/19/15 / #20150329735

Composition for forming transparent resin layer, transparent resin layer, solid imaging element and optoelectronics device

A composition for forming a transparent resin layer of the present invention includes a polymerization initiator having a molar absorption coefficient (ε) at a wavelength of 365 nm of 1000 mol−1·l·cm−1 or less; a polymerizable compound; a polymer; and a solvent. The polymerization initiator is preferably at least one selected from the group consisting of an α-hydroxyacetophenone-based compound and a phosphine-based compound.. ... Fujifilm Corporation

11/19/15 / #20150329467

Fluorine atom-containing phenol compound

A phenol compound is represented by formula (1) (in formula (1), r1 and r2 each independently represent an alkyl group having 1 to 12 carbon atoms; a represents an alkylene group having 1 to 2 carbon atoms; x represents an alkylene group having 1 to 3 carbon atoms optionally containing a hydroxyl group; and y represents a linear perfluoroalkyl group having 4 to 12 carbon atoms). The phenol compound is novel and has excellent affinity for a fluorine-containing polymer and a fluorine-containing solvent.. ... Fujifilm Corporation

11/19/15 / #20150328901

Image formation device, method, program, and formed image

There are provided an image formation device, an image formation method, a program, and an image forming product capable of preventing noise and granularity of an image from deteriorating even when dots with a plurality of dot sizes are arranged to be aggregated. When a continuous tone image signal is a signal which indicates a tint image, at least one of dot aggregation portions 16, 18, 68, and 72 is formed through arrangement for aggregation of dots 14 (dots 14l and 14s) with two or more dot sizes, on a part of dot images 10, 12, 66, and 70 which are indicated by dot image signals. ... Fujifilm Corporation

11/19/15 / #20150327829

Radiographic imaging device and method

Disclosed are a radiographic imaging device and a radiographic imaging method which appropriately set an irradiation condition of radiation according to the presence or absence of an implant in a breast. An implant information acquisition unit 80 acquires implant information representing whether or not an implant is included in a breast m as a subject. ... Fujifilm Corporation

11/19/15 / #20150327828

Body motion display device and body motion display method

Disclosed are a body motion display device and a body motion display method which efficiently performs operation for confirming the presence or absence of body motion included in a radiographic image. An index value calculation unit calculates an index value representing body motion based on the ratio between contrast of a high-frequency component and contrast of a low-frequency component in a radiographic image at an analysis point set by an analysis point setting unit. ... Fujifilm Corporation

11/19/15 / #20150327823

Radiographic imaging device

A radiation imaging apparatus includes a hydrophilized portion provided on at least a portion of an outer surface of the radiation imaging apparatus. The hydrophilized portion contains a hydrophilic polymer and an antibacterial agent. ... Fujifilm Corporation

11/19/15 / #20150327773

Probe

There is provided a photo acoustic probe which prevents foreign substances from entering and of which a portion of a light emitting unit to be easily damaged can be replaced. An acoustic wave detector 24 detects acoustic waves. ... Fujifilm Corporation

11/12/15 / #20150326838

Imaging device, image processing device, image processing method and program

Pixels constituting the imaging element include at least four types of the determination pixels for which color filter patterns of adjacent pixels thereof are different from one another. At least one of pixels, which are adjacent to each determination pixel, is a first color pixel that has a color filter with a first color. ... Fujifilm Corporation

11/12/15 / #20150326810

Radiation detector, radiographic imaging device, and radiographic imaging system

The present invention provides radiation detector, radiographic imaging device and radiographic imaging system that may detect irradiated radiation while maintaining quality of radiographic image. The radiation detector has: pixels having a sensor portion that generates charges in accordance with light converted from irradiated radiation, tft switch that outputs, to a signal line, charges read-out from the sensor portion, and radiation detection tft switch that is not connected to a signal line; and radiation detection pixels that have the sensor portion, the tft switch, and radiation detection tft switch that is connected to a signal line and that outputs, to the signal line, charges read-out from the sensor portion. ... Fujifilm Corporation

11/12/15 / #20150325971

Photoacoustic measurement device and laser light source

A flash lamp 32 excites a laser rod 31. A q switch 35 which changes the loss of the optical resonator according to the voltage applied is inserted on the optical path of a pair of mirrors 33 and 34 forming the optical resonator. ... Fujifilm Corporation

11/12/15 / #20150325810

Organic el laminate

In the organic el laminate, a gas barrier film, which has a laminated structure composed of an organic film and an inorganic film, adheres to a passivation film, which covers a light emitting element using an organic el material, by an adhesive in a state in which the inorganic film faces the passivation film and the inorganic film and the passivation film are formed of the same material.. . ... Fujifilm Corporation

11/12/15 / #20150325769

Thermoelectric generation module

A thermoelectric generation module having: a thermoelectric conversion layer in which a plurality of thermoelectric conversion elements are electrically connected to each other in series and radially disposed in a principal surface direction of a substrate; a heat radiation layer that is connected to a center of the thermoelectric conversion layer and disposed on the side opposite to the principal surface of the substrate; a heat insulating layer disposed at a periphery of the heat radiation layer; and a heat absorbing layer that is connected to the periphery of the thermoelectric conversion layer and disposed on the principal surface side of the substrate, wherein the thermoelectric conversion elements each are composed of a p-type semiconductor and an n-type semiconductor, the p-type semiconductor and the n-type semiconductor are alternately and radially disposed, and electrically connected to each other in series with electrodes in sequence.. . ... Fujifilm Corporation

11/12/15 / #20150323824

Optical film, polarizing plate, and image display device

A film of 15 to 45 μm thick containing a cellulose acylate and an aromatic ester oligomer having a repeating unit derived from a dicarboxylic acid and a repeating unit derived from a diol, in which the repeating unit derived from a dicarboxylic acid has a ratio m/n of from 0/10 to 3/7, m and n represent a molar proportion of a repeating unit derived from an aliphatic dicarboxylic acid and an aromatic dicarboxylic acid, respectively, and the film satisfies. . ... Fujifilm Corporation

11/12/15 / #20150323766

Projection lens and projection display apparatus

A projection lens includes a compound aspherical lens in which a resin layer is formed on a surface of a glass lens and a lens surface of the resin layer on the air contacting surface side has an aspherical shape. If the glass transition temperature of the resin layer is taken as tg and its unit is taken as ° c., tg of at least one of the resin layers is 150<tg<280. ... Fujifilm Corporation

11/12/15 / #20150322063

Nitrogen-containing heterocyclic compound or salt thereof

A compound represented by formula [1] (in the formula, z1 represents n, ch, or the like; x1 represents nh or the like; r1 represents a heteroaryl group or the like; each of r2, r3, and r4 represents a hydrogen atom, a halogen atom, an alkoxy group, or the like; and r5 represents a heteroaryl group or the like) or salt thereof.. . ... Fujifilm Corporation

11/12/15 / #20150321484

Image formation device, method and program

There are provided an image formation device, method, and program capable of forming an image, which is appropriate for a combination of dot sizes, with high flexibility in design for optimizing halftone processing in a case of using a plurality of dot sizes. Two or more combinations are selected among combinations of a plurality of types of threshold matrix and at least one type of division information for classifying a whole range of threshold values covered by the types of threshold matrix into a plurality of divisions. ... Fujifilm Corporation

11/12/15 / #20150320652

Emulsion composition

An emulsion composition includes a compound having a diaminopyrimidine skeleton, at least one fatty acid component selected from the group consisting of a fatty acid having a total carbon number of 14 or more and a salt thereof, and an aqueous medium in an amount of 50% by mass or more with respect to the mass of the emulsion composition. The total amount of monohydric alcohol having a total carbon number of 3 or less and dihydric alcohol having a total carbon number of 3 or less is less than 10% by mass with respect to the mass of the emulsion composition. ... Fujifilm Corporation

11/12/15 / #20150320377

Medical image display control apparatus, method, and program

A medical image display control apparatus includes a medical image obtaining unit that obtains a set of time series medical images captured by successively imaging the same subject, an observation position obtaining unit that obtains anatomically common positions in the set of medical images as observation positions, and a display control unit that successively displays the set of medical images such that the observation positions in the set of medical images are displayed at the same position on a display screen.. . ... Fujifilm Corporation

11/05/15 / #20150319412

Pixel correction method and image capture device

. . . . . . . . A color image sensor comprises normal pixels and phase difference pixels. A pixel combining circuit combines pixel signals of the normal pixels, and combines pixel signals of the normal pixel and the phase difference pixel of the same color. ... Fujifilm Corporation

11/05/15 / #20150318013

Multilayer optical information recording disk and method for manufacturing same

A multilayer optical information recording disk comprising a plurality of recording layers and intermediate layers provided between the plurality of recording layers, and a method for manufacturing the same are provided. At least one of two intermediate layers disposed adjacent to respective sides of one recording layer is made of adhesive. ... Fujifilm Corporation

11/05/15 / #20150317799

Medical image processing apparatus, method, and program

A medical image processing apparatus includes a medical image data obtaining unit for obtaining medical image data containing an image of a heart, and a region extraction processing unit for extracting a left ventricular region of the heart in the medical image data obtained by the medical image data obtaining unit, and, based on an extraction result of the left ventricular region, performing region extraction processing for extracting at least one of a right ventricular region, a left atrium region, and a right atrium region of the heart.. . ... Fujifilm Corporation

11/05/15 / #20150317798

Region segmentation apparatus, recording medium and method

A candidate-region for an object-region is set in an image. In a graph including point-s corresponding the object-region, point-t corresponding to a background-region, a point corresponding to each pixel in the image, s-link connecting each pixel and point-s, t-link connecting each pixel and point-t, and n-link connecting each pair of adjacent pixels, a cost is set for each link, graph-cut is performed. ... Fujifilm Corporation

11/05/15 / #20150317776

Image processing device and image capture device

An image processing device according to an embodiment of the present invention obtains recovery image data by performing restoration processing using a restoration filter based on a point spread function of an optical system, on original image data obtained from an imaging element by imaging using the optical system. The restoration filter used in this restoration processing (a combination filter and realization filter fr) is generated by combining multiple base filters fb. ... Fujifilm Corporation

11/05/15 / #20150316844

Curable composition and color filter

Provided is a colored curable composition having a good chemical resistance, and capable of forming a good colored layer pattern, the colored curable composition including an epoxy group-containing compound, and a phthalocyanine dye having a functional group capable of forming a covalent bond by a reaction with the epoxy group under heating.. . ... Fujifilm Corporation

11/05/15 / #20150314903

Automatic taking-out method and device for packaged contents

An automatic taking-out device is configured by providing a package holding unit that holds the package; a cutting unit that cuts the two packaging sheet materials of the package in a held state in two cutting spots that are respectively present between the joining portions and the contents and that face each other with the contents therebetween; a pair of suction units that respectively suction and hold the two packaging sheet materials inside the two cutting spots; a driving unit that moves at least one of the suction units in a direction separated from the contents; and an inclining unit that inclines the two packaging sheet materials inside the two cutting spots and the contents in a state where a positional deviation in an up-down direction occurs with respect to the two cutting spots, and drops the contents out of the two packaging sheet materials.. . ... Fujifilm Corporation

11/05/15 / #20150314609

Fluid circulation

Among other things, an apparatus for use in fluid jetting is described. The apparatus includes a printhead including a flow path and a nozzle in communication with the flow path that has a first end and a second end. ... Fujifilm Corporation

11/05/15 / #20150314580

Lamination method and laminate

A lamination method includes: a bonding step of bonding a support to a main surface of a substrate while transporting the substrate and the support along predetermined transport paths; and a curing step of curing an adhesive after the bonding step, and the bonding step is performed to bond the substrate and the support together while sequentially passing the substrate and the support through two or more nip roller pairs and, of the two or more nip roller pairs, a nip roller pair provided downstream has a nip distance set to be equal to or smaller than a nip distance of a nip roller pair provided upstream. The lamination method and a laminate obtained thereby can reduce film thickness variations in a substrate to achieve a high film thickness accuracy, ensures high versatility, and can suppress cost increases.. ... Fujifilm Corporation

11/05/15 / #20150313580

Tissue sampling device

A tissue sampling device including a flexible sheath, a cannula inserted into the sheath so as to be movable back and forth and punctured into body tissue, and an operation unit provided on a proximal end side of the sheath to move the cannula back and forth, wherein the cannula has a distal end part including a slit extending from a distal end opening toward a proximal end side.. . ... Fujifilm Corporation

11/05/15 / #20150313576

Ultrasound diagnostic apparatus

An ultrasound diagnostic apparatus includes: a transducer array; a transmission circuit transmitting an ultrasonic beam from the transducer array; a reception circuit obtaining fundamental component data based on reception signals corresponding to the fundamental component of an ultrasonic wave and harmonic component data based on reception signals corresponding to a harmonic component of the ultrasonic wave; and an image producer performing frame correlation processing on the fundamental component data and the harmonic component data generated for each frame so as to produce an ultrasound image. The frame correlation processing is performed such that the weight of harmonic component data of another frame used in the frame correlation processing of the harmonic component data is greater than the weight of fundamental component data of another frame used in the frame correlation processing of the fundamental component data.. ... Fujifilm Corporation

11/05/15 / #20150313517

Endoscope system

The invention provides an endoscope system for generating an oxygen saturation image that can be used for various medical applications, such as oxygen saturation monitoring during surgery. A clip 141 is attached to the surrounding tissue of a tumor cn from the luminal side. ... Fujifilm Corporation

10/29/15 / #20150312516

Wide dynamic range electronic image recording and reproducing system

. . . . . . The electronic camera has an imaging device that images a subject with subject reflectance r (%) with a dynamic range wider than that at displaying or printing to acquire image data and a recording device that converts the image data acquired by the imaging device with a predetermined function and records the converted image data and the information on the function as digital values (digit). Therefore, a printed image with an automatically or manually corrected density can be obtained at the displaying or the printing.. ... Fujifilm Corporation

10/29/15 / #20150312505

Image processing device, imaging device, image processing method, and non-transitory computer readable medium

An image processing device includes a gain correction processing unit, an interpolation correction processing unit, an image processing unit. Within a range including a correction target phase difference detecting pixel and a plurality of capturing pixels adjacent to the correction target phase difference detecting pixel and detecting the same color as a color of the correction target phase difference detecting pixel, when a signal value obtained by correcting an output signal of the correction target phase difference detecting pixel using gain correction processing is sc, in a case in which sc<th1 or sc>th2, the image processing unit records, in a recording medium, a signal obtained by correcting the output signal of the correction target phase difference detecting pixel by the interpolation correction processing unit.. ... Fujifilm Corporation

10/29/15 / #20150312483

Endoscope apparatus, image processing apparatus and image adjusting method

An endoscope apparatus includes an observation optical system, a solid-state imaging element, a memory section, and an image processing section, wherein the memory section stores the information therein for specifying the image cutting-out region for the process of cutting out the image for display, which corresponds to an overlapping region in which a displayable pixel area of the solid-state imaging element and an imaging area of the optical image to be formed on the solid-state imaging element by the observation optical system overlap one another, and overlap one another when the center of the imaging area is matched with the center of the display area, as the image cutting-out information, and the image processing section expands the image for display to an image size of the display area, when an image size of the cut-out image for display becomes smaller than the image size of the display area.. . ... Fujifilm Corporation

10/29/15 / #20150311564

Electrolytic solution for non-aqueous secondary cell, non-aqueous secondary cell, and additive for electrolytic solution

The present invention provides an electrolytic solution for a non-aqueous secondary cell and an additive for an electrolytic solution. The electrolytic solution includes, in an organic solvent: an electrolyte; and an organic boron compound having at least one nitrogen-boron bond or an organic aluminum compound having at least one nitrogen-aluminum bond. ... Fujifilm Corporation

10/29/15 / #20150311558

Electricity generation

A method for generating electricity comprising the steps: (a) passing a concentrated ionic solution through a first pathway in a reverse electrodialysis unit comprising a membrane stack having electrodes and alternating cation and anion exchange membranes; and (b) passing a dilute ionic solution through a second pathway in said reverse electrodialysis unit, whereby solute from the concentrated solution in the first pathway passes through the membranes to the dilute solution in the second pathway, thereby generating electricity; wherein the concentration of solute in the dilute ionic solution as it enters the reverse electrodialysis unit is at least 0.03 mol/l.. . ... Fujifilm Corporation

10/29/15 / #20150309408

Negative resist composition, resist film using same, pattern forming method, and mask blank provided with resist film

A negative resist composition includes an onium salt compound (a) containing a nitrogen atom in its cation moiety, a compound (b) that is configured to produce an acid when exposed to actinic rays or radiation, and a compound (c) containing an acid-crosslinkable group.. . ... Fujifilm Corporation

10/29/15 / #20150309307

Mirror drive device and driving method thereof

In a mirror drive device, a first and second actuator sections are arranged on both sides of a mirror supporting section that supports a mirror section so as to sandwich the mirror supporting section. Division of an upper and lower electrodes of each of the first and second actuator sections is performed correspondingly to stress distribution of principal stresses in a piezoelectric body in resonant mode vibration, and a piezoelectric body portion corresponding to positions of a first and third upper electrode sections, and a piezoelectric body portion corresponding to positions of a second and fourth upper electrode sections have stresses in opposite directions to each other. ... Fujifilm Corporation

10/29/15 / #20150309292

Zoom lens and imaging apparatus

A zoom lens consists of a positive first lens group fixed during zooming, a negative second lens group moved during zooming, a positive third lens group moved during zooming to correct an image plane variation due to the zooming, and a positive fourth lens group fixed during zooming and includes a stop on the most object side. The second lens group includes two or more positive lenses and one or more negative lenses. ... Fujifilm Corporation

10/29/15 / #20150309287

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens consists of five lenses, including: a first lens having a positive refractive power and a meniscus shape with a convex surface toward the object side, a second lens having a biconcave shape with the surface having the radius of curvature with the smaller absolute value toward the image side, a third lens having a meniscus shape with a convex surface toward the object side, a fourth lens having a negative refractive power and a meniscus shape with a convex surface toward the image side, and a fifth lens having a negative refractive power and a meniscus shape with a concave surface toward the image side, the image-side surface thereof having at least one inflection point, disposed in this order from the object side.. . ... Fujifilm Corporation

10/29/15 / #20150306870

Head adjustment method, head-driving device and image-forming device

According to an aspect of the present invention, in a case where a part of the plurality of head modules to each of which an initial amount of correction is set is replaced, a mounting position of the replaced head module in the first direction varies in a range within the mounting tolerance. However, the initial amount of correction in the first direction of each of the head modules is set by adding the amount of the offset more than the mounting tolerance, a mounting position of the replaced head module is always upstream from the offset reference line in the feeding direction of a recording medium. ... Fujifilm Corporation

10/22/15 / #20150304547

Image processing device, imaging device, image processing method and computer readable medium

. . . . An generation section generates a first display image based on an image signal output from an image pick-up device including first and second pixel groups on which respective images are formed by a pupil-divided subject-image, and generates a second display image for use in focus verification from first and second images based on an image signal output from the first and second pixel groups. A display controller performs control to display the first display image on a display section, and to display the second display image on the display section within a display region of the first display image. ... Fujifilm Corporation

10/22/15 / #20150304546

Image processing device, imaging device, image processing method and computer readable medium

A sensitivity acquisition section that acquires sensitivity to light incident through the first region of pixels in a pupil division direction of the first pixel group, and acquires sensitivity to light incident through the second region of pixels in the pupil division direction of the second pixel group; a correction section that derives linearly approximated sensitivity correction coefficients for each of the first image and the second image based on the sensitivities, and corrects the brightness of the first and second images based on the derived sensitivity correction coefficients; and a generation section that generates a first display image based on an image signal output from the image pick-up device, and generates a second display image for use in focus verification based on the first and second images corrected by the correction section.. . ... Fujifilm Corporation

10/22/15 / #20150304529

Image processing device, imaging device, program, and image processing method

Provided are an image processing device, an imaging device, a program, and an image processing method which can suppress a reduction in the visibility of a split image when distortion is corrected. A first display image which is used as a live view image and a second display image which is used to check a focus are generated on the basis of an image signal output from an imaging element including first and second pixel groups on which an object image that passes through first and second regions of an imaging lens and is pupil-divided is formed (s403, s415). ... Fujifilm Corporation

10/22/15 / #20150302880

Magnetic powder and method of manufacturing the same, and its usage

An aspect of the present invention relates to a method of manufacturing magnetic powder, which comprises adding an alkali metal salt compound comprising a substituent selected from the group consisting of an alkali metal salt of a carboxyl group and an alkali metal salt of a hydroxyl group to a water-based magnetic liquid comprising magnetic particles dispersed in an acidic water-based solvent to cause the magnetic particles to aggregate in the water-based magnetic liquid; and collecting the aggregated magnetic particles to obtain the magnetic powder.. . ... Fujifilm Corporation

10/22/15 / #20150302615

Image processing device, radiographic imaging system, recording medium storing image processing program, and image processing method

An image processing device that includes: an acquiring section that acquires a plurality of projection images in which a subject between a radiation detector and a radiation applying unit has, as a result of the radiation applying unit being moved to thereby change an angle of incidence, with respect to the subject, of radiation applied from the radiation applying unit, been imaged at each different angle of incidence; a processing section that performs frequency processing that attenuates, relative to a high-frequency component, a low-frequency component of projection images in which the angle of incidence is equal to or greater than a first threshold; and a tomographic image generating section that generates tomographic images of the subject by image reconstruction from projection images in which the angle of incidence is less than the first threshold and from the frequency-processed projection images.. . ... Fujifilm Corporation

10/22/15 / #20150301430

Camera apparatus, camera body, interchangeable lens, and method of controlling operation of camera body

The invention speeds up operation of an interchangeable lens. The interchangeable lens, which is removably mounted on a camera body, includes a communication control microcomputer, a lens driving circuit and a lens driving actuator. ... Fujifilm Corporation

10/22/15 / #20150301403

Polarizing plate, image display apparatus, and liquid crystal display apparatus

A polarizing plate includes: a polymer film; a polarizer; and a stress relaxation layer disposed between the polymer film and the polarizer, wherein a relationship of the following expression (1) is satisfied, a thickness of the polymer film is equal to or greater than 10 μm, a distance(ds) from the surface of the polarizing plate on the side of the polymer film to the interface between the polymer film and the stress relaxation layer is equal to or greater than 15 μm, a difference between the distance(ds) and a thickness(c) of the polymer film is less than 15 μm, and a total thickness of the polymer film and the stress relaxation layer is equal to or less than 80 μm, 0.01<b/a<0.9 . . ... Fujifilm Corporation

10/22/15 / #20150301319

Zoom lens and imaging apparatus

A zoom lens consists of, in order from the object side, a positive first lens group, a negative second lens group, a negative third lens group, a negative fourth lens group, a positive fifth lens group, and a positive sixth lens group. The first lens group and the sixth lens group are fixed with respect to an image plane, and a distance between the first lens group and the second lens group increases, a distance between the second lens group and the third lens group changes, and a distance between the third lens group and the fourth lens group changes, and a distance between the fourth lens group and the fifth lens group changes, and a distance between the fifth lens group and the sixth lens group changes during magnification change from a wide angle end to a telephoto end.. ... Fujifilm Corporation

10/22/15 / #20150301245

Near-infrared-absorbing composition, near-infrared cut-off filter using same, manufacturing method therefor, camera module, and manufacturing method therefor

An object of the present invention is to provide a near-infrared-absorbing composition capable of forming a cured film having excellent heat resistance while maintaining strong near-infrared shielding properties when a cured film is produced. The near-infrared-absorbing composition of the present invention includes a copper complex obtained by reacting two or more kinds of sulfonic acids represented by general formula (i) described below or salts thereof with a copper component and a solvent.. ... Fujifilm Corporation

10/22/15 / #20150301200

Radiographic image detector

A flat panel detector (fpd) includes an imaging panel having pixels arranged in a matrix, a gate driver for turning thin film transistors (tfts) of the pixels on and off, a radiation detecting section for detecting the start of x-ray radiation from the x-ray source, and a controller. The controller controls the gate driver to turn the tfts on periodically to reset dark charges of the pixels. ... Fujifilm Corporation

10/22/15 / #20150298174

Piezoelectric transducers using micro-dome arrays

An ultrasonic piezoelectric transducer device includes a transducer array consisting of an array of vibrating elements, and a base to which the array of vibrating elements in the transducer array are attached. The base include integrated electrical interconnects for carrying driving signals and sensed signals between the vibrating elements and an external control circuit. ... Fujifilm Corporation

10/22/15 / #20150298173

Piezoelectric transducers using micro-dome arrays

An ultrasonic piezoelectric transducer device includes a transducer array consisting of an array of vibrating elements, and a base to which the array of vibrating elements in the transducer array are attached. The base include integrated electrical interconnects for carrying driving signals and sensed signals between the vibrating elements and an external control circuit. ... Fujifilm Corporation

10/22/15 / #20150298071

Composite gas separation membranes with dialkysiloxane intermediate layer

A composite membrane comprising: (a) a porous support; (b) a gutter layer; (c) a discriminating layer having an average thickness of at most 90 nm; and (d) a protective layer having an average thickness 150 nm to 600 nm comprising dialkylsiloxane groups.. . ... Fujifilm Corporation

10/22/15 / #20150297192

Hand-held medical imaging system with dedicated power source devices and associated apparatuses and methods

A portable ultrasound system having dedicated power source devices is disclosed herein. In one embodiment, a portable ultrasound system can include transducer electronics and a base unit having base-unit electronics configured to receive user input and to operate the transducer electronics to perform ultrasound scanning based on the user input. ... Fujifilm Corporation

10/22/15 / #20150297185

Hand-held medical imaging system with thumb controller and associated systems and methods

A portable ultrasound system having a thumb controller is disclosed herein. A portable ultrasound system configured in accordance with one embodiment of the disclosure includes a transducer device and a hand-held base unit removably coupled to the transducer device. ... Fujifilm Corporation

10/22/15 / #20150297179

Hand-held medical imaging system with improved user interface for deploying on-screen graphical tools and associated apparatuses and methods

A portable ultrasound system having an enhanced user interface is disclosed herein. In one embodiment, a portable ultrasound system can include a hand-held base unit configured to present a graphical user interface that contains a first control area, a second control area, and an active image area. ... Fujifilm Corporation

10/22/15 / #20150297167

Radiation imaging apparatus and control method thereof, and radiation imaging system

An fpd detects an x-ray image of an object. The fpd includes a plurality of pixels arranged in its image capturing field. ... Fujifilm Corporation

10/22/15 / #20150297092

Photoacoustic image generating device and insertion object

Even when an insertion object is inserted to a deep position of a subject or even when the insertion object is inserted into the subject at an angle close to a right angle, it is possible to confirm the position of the insertion object in a photoacoustic image. The insertion object is, for example, a hollow puncture needle 15 that includes an opening at a tip thereof. ... Fujifilm Corporation

10/01/15 / #20150281560

Image processing device, imaging device, image processing method and computer readable medium

. . . . . . . . An image processing device comprising: a determination section that, based on a factor defining a depth representing a permissible range for acceptable state of focus and on parallax computed by a parallax computation section, determines an operation movement ratio for converting an operation amount, that instructs movement of a focusing lens, into a movement amount of the focusing lens by using a function including the operation movement ratio as a dependent variable and an independent variable determined according to the factor and the parallax; and a control section that controls a movement section to move the focusing lens by an amount equivalent to a movement amount determined based on an operation movement ratio determined by the determination section and the operation amount.. . ... Fujifilm Corporation

10/01/15 / #20150279407

Method of manufacturing hexagonal ferrite powder, hexagonal ferrite powder, and magnetic recording medium

An aspect of the present invention relates to a method of manufacturing hexagonal ferrite powder, which comprises introducing a hexagonal ferrite precursor and an organic compound, either simultaneously or sequentially, into a feed passage into which water is being continuously fed while being heated and pressurized, continuously feeding a water-based solution comprising at least the hexagonal ferrite precursor, the organic compound, and water through the feed passage to a reaction flow passage within which a fluid flowing therein is subjected to heating and pressurizing to convert the hexagonal ferrite precursor into hexagonal ferrite in the reaction flow passage, discharging and feeding a water-based comprising the hexagonal ferrite from the reaction flow passage to a cooling element, and recovering the hexagonal ferrite from the water-based solution that has been cooled in the cooling element, wherein a solution temperature at the point of first contact between the hexagonal ferrite precursor and the organic compound is equal to or higher than 200° c. But lower than 300° c., and a ph of the water-based solution that has been cooled is equal to or higher than 6.0 but equal to or lower than 12.0.. ... Fujifilm Corporation

10/01/15 / #20150279406

Method of manufacturing hexagonal ferrite powder, hexagonal ferrite powder, and magnetic recording medium

An aspect of the present invention relates to a method of manufacturing hexagonal ferrite powder, which comprises heating to equal to or higher than 300° c. And pressurizing to equal to or higher than 20 mpa a hexagonal ferrite precursor-containing water-based solution, to convert the precursor to hexagonal ferrite, wherein the water-based solution comprises at least a reducing compound selected from the group consisting of a reducing inorganic compound and a reducing organic compound that have a reducing property and exist as a solid or a liquid at ordinary temperature and ordinary pressure, as well as, when the reducing compound is a reducing inorganic compound, the water-based solution further comprises an organic compound.. ... Fujifilm Corporation

10/01/15 / #20150279196

Electronic cassette management system, method of operating electronic cassette management system, and electronic cassette management device

A first data taking section takes first detection results from a first wireless tag reader which detects the come and go of an electronic cassette into and out of a first service zone, and also takes second detection results from a second wireless tag reader which detects the come and go of an electronic cassette into and out of a second service zone. A first alert controller drives a first speaker to start an alert when the first alert controller determines on the basis of the first detection results that the electronic cassette has gone out the first service zone. ... Fujifilm Corporation

10/01/15 / #20150279120

Three dimensional orientation configuration apparatus, method and non-transitory computer readable medium

A projection image of a three dimensional image is generated and displayed and a three dimensional target point corresponding to a designated two-dimensional target point is set to the three dimensional image. A reference cross-section is set to the three dimensional image by using the three dimensional target point. ... Fujifilm Corporation

10/01/15 / #20150279030

Image processing apparatus, image processing method, and non-transitory storage medium storing program

An image processing apparatus includes a first image generator for generating a first image by rotating an original image through a first angle, a second image generator for generating a second image by rotating the original image through a second angle of 90°×n, where n is an integer, that is closest to the first angle, and a display unit for displaying the first image and the second image for comparison with each other.. . ... Fujifilm Corporation

10/01/15 / #20150278595

Image layout generating apparatus, image product creation system, image layout generating method, and recording medium for image layout generating program

An image layout generating apparatus includes: a first image arranging unit for extracting a first piece of image data from a plurality of image data, and arrange a first image; an image data extracting unit for extracting a new piece of image data; an arranged image selecting unit configured to calculate an inter-image distance between the new piece of image data and image data of each arranged image, and select one of the arranged images; a second image arranging unit configured to arrange a new image to be above, below, left, or right of the selected arranged image by adjusting a size while maintaining an aspect ratio of the new image; and a size adjusting unit configured to adjust the sizes while maintaining the aspect ratios of all the arranged images so as to configure one set of images in which all of the arranged images overall form a rectangle.. . ... Fujifilm Corporation

10/01/15 / #20150278581

Central person determining system, information terminal used in the same, central person determining method, and recording medium for central person determining program

A central person determining system includes an information terminal having a plurality of image data; and a server; wherein the information terminal performs face detection processing and generates a face detection result for each of a plurality of images based on the plurality of image data, generates a plurality of face image data by cropping, on the basis of the face detection result, a face image from the plurality of images based on the plurality of image data, and transmits the plurality of face image data to the server; and wherein the server performs central person determining processing on the basis of the plurality of face image data acquired from the information terminal, generates the central person determining result, and transmits the central person determining result to the information terminal.. . ... Fujifilm Corporation

10/01/15 / #20150278460

Endoscopic scope cleaning management system, endoscopic scope cleaning management method, and non-transitory computer readable medium

An endoscopic scope cleaning management system includes: an inspection order information storage unit which stores inspection order information including information of inspection date and time of an endoscope inspection using an endoscopic scope; an endoscopic scope specification unit which specifies an endoscopic scope to be used based on the inspection order information stored in the inspection order information storage unit; a cleaning necessity determination unit which stores cleaning history information of each endoscopic scope and determines whether it is necessary to clean the endoscopic scope to be used which is specified by the endoscopic scope specification unit, using the cleaning history information of the endoscopic scope to be used; and an information creation unit which creates and outputs information for notifying a user of the necessity to clean a cleaning-needed endoscopic scope for which it is determined by the cleaning necessity determination unit that the cleaning is required.. . ... Fujifilm Corporation

10/01/15 / #20150278445

Inspection report creation support system, medical image diagnosis apparatus, inspection report creation support method, and non-transitory computer readable medium

A medical image diagnosis apparatus which acquires inspection image data by shooting an inspection area and is communicatively connected to an image server that stores the acquired inspection image data and a client terminal in which creation of an inspection report is performed, through a network, in which the medical image diagnosis apparatus includes a storage unit which temporarily stores specific information for specifying an inspection and the inspection image data acquired through the inspection in association with each other, and transmits the inspection image data to the client terminal when the inspection image data is stored in the storage unit in response to a transmission request for the inspection image data of the inspection specified by the specific information being received from the client terminal.. . ... Fujifilm Corporation

10/01/15 / #20150277831

Print production system, print production method, non-transitory storage medium storing print production program, and printing management server

A print production system includes an order-receiving server and a printing management server. The order-receiving server transmits an electronic operation manual including ordering information to the printing management server. ... Fujifilm Corporation

10/01/15 / #20150277812

Page allocation table determining apparatus, page allocation table determining method, and non-transitory storage medium storing page allocation table determining program

If a page allocation table determining apparatus receives a change, either in the content of items in a page allocation table screen that is displayed by a display unit, or in the plotted content of an imposition screen, which is displayed by the display unit in response to an action taken by the user, the page allocation table determining apparatus generates a page allocation table screen and an imposition screen that simultaneously reflect such a change. Based thereon, the display unit simultaneously displays the page allocation table screen, which simulates the page allocation table, and the imposition screen, which simulates a layout of imposed pages.. ... Fujifilm Corporation

10/01/15 / #20150277225

Actinic-ray-sensitive or radiation-sensitive resin composition, resist film formed using said composition, method for forming pattern using said composition, process for producing electronic device, and electronic device

An actinic-ray-sensitive or radiation-sensitive resin composition contains a compound (a) which generates acid by being irradiated with actinic rays or radiation where, when relative light absorbance is εr using triphenyl sulfonium nonaphlate as a reference and relative quantum efficiency is φr using triphenyl sulfonium nonaphlate as a reference, the relative light absorbance εr is 0.4 to 0.8 and εr×φr is 0.5 to 1.0.. . ... Fujifilm Corporation

10/01/15 / #20150277089

Retrofocus-type wide angle lens and imaging apparatus

A retrofocus-type wide-angle lens consists of a negative first lens-group, a positive second lens-group, and a positive third lens-group in this order from an object-side. The first lens-group consists of a positive meniscus-lens with its convex surface facing the object-side and three negative meniscus-lenses with their convex surfaces facing the object-side in this order from the object-side. ... Fujifilm Corporation

10/01/15 / #20150277085

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is constituted essentially by six lenses, including: a first lens of a biconvex shape; a second lens having a negative refractive power and is of a meniscus shape with a concave surface toward the image side; a third lens of a meniscus shape with a convex surface toward the object side; a fourth lens of a meniscus shape with a concave surface toward the object side; a fifth lens having a positive refractive power; and a sixth lens having a negative refractive power and a concave surface toward the image side, provided in this order from the object side.. . ... Fujifilm Corporation

10/01/15 / #20150277007

Liquid crystal compound, optical film, and method for producing optical film

An optical film of the present invention includes an optically anisotropic layer containing a compound represented by the following general formula (1) or an optically anisotropic layer formed by the curing of a polymerizable composition containing a compound represented by the following general formula (1):. . ... Fujifilm Corporation

10/01/15 / #20150277006

Optical film, polarizing plate, and method for producing optical film

An optical film of the present invention includes a positive a-plate and a positive c-plate, in which the re(450), re(550), and re(650) of the positive a-plate satisfy the relationship of re(450)≦re(550)≦re(650), the positive a-plate is formed of a cured product of a composition including the liquid crystal compound a, and the positive c-plate is formed of a cured product of a composition including the liquid crystal compound c.. . ... Fujifilm Corporation

10/01/15 / #20150277002

Curable resin composition, infrared ray cutoff filter and solid-state imaging device using the same

According to an exemplary embodiment of the present invention, there is provided a curable resin composition comprising a dye having a maximum absorption wavelength in a range of 600 nm to 820 nm, and being capable of forming a high refractive index layer with a refractive index ranging from 1.65 to 2.00.. . ... Fujifilm Corporation

10/01/15 / #20150276991

Antireflective article, image display device, and method of manufacturing antireflective article

There is provided an antireflective article including a chemically reinforced glass substrate with a surface compressive stress of 30 kg/mm2 or more and an antireflection layer containing a specific binder resin, specific metal oxide particles, and a specific metal chelate catalyst, above the chemically reinforced glass substrate, wherein the antireflection layer has a moth-eye structure in an unevenness shape constituted by the metal oxide particles on a surface at a side opposite to a side at which the chemically reinforced glass substrate is provided.. . ... Fujifilm Corporation

10/01/15 / #20150276944

Electronic cassette

An electronic cassette is provided with a sensor panel, a housing, operation buttons, a head-bottom setting section, lamps and a memory. The sensor panel has a quadrangle imaging area, and detects an x-ray image of a patient. ... Fujifilm Corporation

10/01/15 / #20150276940

Radiation detecting device, manufacturing method for radiation detecting device

A radiation detecting device of the present invention includes a scintillator that converts radiation into light, a substrate that supports the scintillator and includes plural sensor portions that generate charges according to the light converted by the scintillator, a thermoplastic resin layer provided on the scintillator, a first organic layer provided on the thermoplastic resin layer, and an inorganic reflection layer provided on the first organic layer. The melting start temperature of the thermoplastic resin layer is lower than the melting start temperature of the first organic layer, the scintillator includes a projection portion on a surface on the side provided with the thermoplastic resin layer, and a leading end of the projection portion penetrates the thermoplastic resin layer and makes contact with the first organic layer.. ... Fujifilm Corporation

10/01/15 / #20150275029

Sealing resin composition, sealing film, wiring board, tft device, oled device, and led device

A sealing resin composition, which coats silver wiring or a laminate including the silver wiring, comprises: a fluorine-based resin (a); and a migration inhibitor (b) having a fluorine content rate of equal to or more than 35 mass % and less than 65 mass %, wherein the mass ratio ((b)/(a)) of the migration inhibitor (b) to the fluorine-based resin (a) is equal to or more than 0.0010 and less than 0.10.. . ... Fujifilm Corporation

10/01/15 / #20150275028

Method of manufacturing hard coat film

An aspect of the present invention relates to method of manufacturing a hard coat film, wherein the hard coat film comprises a plastic substrate and a hard coat layer, the method comprises forming the hard coat layer by subjecting a photopolymerizable hard coating composition to photopolymerization processing, and the photopolymerizable hard coating composition comprises a radical polymerizable compound having two or more radical polymerizable groups selected from the group consisting of acryloyloxy groups, acryloyl groups, methacryloyloxy groups, and methacryloyl groups per molecule, a cationic polymerizable compound, a radical photopolymerization initiator, and a cationic photopolymerization initiator.. . ... Fujifilm Corporation

10/01/15 / #20150274957

Polarizing plate protective film, polarizing plate, liquid crystal display device, and production method of polarizing plate protective film

There is provided a polarizing plate protective film comprising a substrate film, and a layer formed by curing a curable composition containing, setting a total solid content of the curable composition to 100 mass %, from 50 to 90 mass % of the following (a) and from 10 to 40 mass % of the following (b) based on the total solid content, (a) a compound having three or more ethylenically unsaturated double bonds in the molecule, and (b) a rosin compound having an acid value of 150 to 400 mgkoh/g.. . ... Fujifilm Corporation

10/01/15 / #20150272998

Composition comprising cell and biocompatible polymer

It is an object of the present invention to provide a cell-containing composition capable of suppressing the outflow of the cells after transplantation and improving the survival rate of the cells. The present invention provides a composition which comprises any of bone marrow stromal cell-derived neural precursor cells, bone marrow stromal cell-derived schwann cells, or bone marrow stromal cell-derived skeletal muscle cells; and a biocompatible polymer.. ... Fujifilm Corporation

10/01/15 / #20150272430

Endoscope

A point within a three dimensional region represented by volume data is set as a target point. A three dimensional angular range having the target point as its apex is set, and a plurality of line of sight vectors directed toward the target point are set within the three dimensional angular range. An endoscope includes: a tip portion main body provided at a tip portion of an insertion section; a camera unit attachment hole provided so as to penetrate the tip portion main body; a camera unit of which tip portion is fitted into a tip portion of the camera unit attachment hole; a locking member disposed at an outer peripheral surface of the camera unit so as to be movable in a direction that is orthogonal to the axial direction; a projection provided on either one of the locking member and the camera unit; a sliding portion provided on the other one of the locking member and the camera unit; and a locking biasing member configured to bias the locking member in the direction t orthogonal to the axial direction within the camera unit attachment hole and to push the locking member against the camera unit attachment hole.. . ... Fujifilm Corporation

10/01/15 / #20150272429

Endoscope system, operation method for endoscope system, processor device, and operation method for processor device

The endoscope system includes an image signal acquisition processing unit and an image generation unit that acquire a first still image and a video or a second still image before and after acquisition of the first still image based on an image signal obtained by imaging an observation target using an image sensor, an association unit that associates the first still image with the video or associates the first still image with the second still image, and a storage unit that stores the first still image and the video associated with each other or stores the first still image and the second still image associated with each other.. . ... Fujifilm Corporation

10/01/15 / #20150272426

Electronic endoscope and electronic endoscope device

There is provided an electronic endoscope and an electronic endoscope device with increased noise resistance. An electronic endoscope includes a connector that is connected to a processor device, and transmission and reception of electric power and signals are performed between the connector and the processor device. ... Fujifilm Corporation

10/01/15 / #20150272425

Endoscope

An endoscope includes an insertion unit, a hardness varying member, a hardness varying wire and a relay member. The insertion unit includes a tip portion, a bending portion, and a flexible portion. ... Fujifilm Corporation

10/01/15 / #20150272424

Flexible tube for endoscope and method for manufacturing the same

A flexible tube for an endoscope includes a flexible tube base, an outer coating layer including a soft resin layer and a hard resin layer, a ratio changing portion, and a tapered portion. In the ratio changing portion, a percentage of a thickness of the hard resin layer decreases and a percentage of a thickness of the soft resin layer increases toward a distal side from a proximal side of the base. ... Fujifilm Corporation

10/01/15 / #20150272422

Endoscope system, processor device, and method for operating endoscope system

An endoscope system comprises an led light source unit, an image sensor, an imaging distance calculator and a light source controller. The led light source unit generates illumination light. ... Fujifilm Corporation

09/24/15 / #20150271461

Image processing device, image processing method, and recording medium

. . According to an aspect of the present invention, when the abnormal oblique incident light is not detected, the first color mixture correction based on the pixel data of the adjacent pixel to the correction target pixel is performed for the pixel data of the correction target pixel, and when the abnormal oblique incident light is detected, the second color mixture correction based on the pixel data of the peripheral pixel to the correction target pixel is performed. Therefore, this aspect can be applied, particularly, even to an imaging element having a large array matrix size, and it is possible to solve the level difference among same-color pixels that occurs due to the influence of the leakage of the abnormal oblique incident light (the ghost light and the like) to the adjacent pixel, and to suppress the image quality degradation due to the abnormal oblique incident light.. ... Fujifilm Corporation

09/24/15 / #20150271374

Imaging lens and imaging apparatus equipped with the same

An imaging lens consists of a front group having a positive refractive power, a stop, and a rear group having a positive refractive power. The front group is composed of a front group negative lens group constituted by two or more negative lenses and a front group positive lens group constituted by a plurality of lenses with a positive lens being disposed on the most object side to have a positive refractive power, in order from the object side. ... Fujifilm Corporation

09/24/15 / #20150270474

Ultrasound probe

There is provided an ultrasound probe capable of efficiently discharging heat generated in a plurality of piezoelectric elements to the outside. A heat collecting portion that includes at least one heat conducting path and is formed of a material having a higher thermal conductivity than a backing member collects heat from a plurality of piezoelectric elements, and a heat exhausting portion connected to the heat collecting portion discharges the heat collected in the heat collecting portion to the outside. ... Fujifilm Corporation

09/24/15 / #20150269750

Medical image processing device and method for operating the same

Rgb image signals are inputted. B/g ratio is calculated based on b image signal and g image signal. ... Fujifilm Corporation

09/24/15 / #20150269741

Medical image processing device and method for operating the same

Rgb image signals are inputted. B/g ratio is calculated based on b image signal and g image signal. ... Fujifilm Corporation

09/24/15 / #20150269325

Medical test result display device and method for operating the same

A medical test result display device is provided, which enables checking test values of important test items determined according to the test purpose without the need for cumbersome operations. A test result collection and integration server collects medical information and medical images of a designated patient from a medical record storage server, and produces a test result display screen that integrates the medical information and images. ... Fujifilm Corporation

09/24/15 / #20150268545

Projection-type display apparatus

A projection-type display apparatus includes a light source unit, a first optical system that rays from the light source unit enter, a second optical system that rays from the first optical system enter, an image display device that rays from the second optical system enter, and a projection lens that magnifies and projects an optical image formed by rays that have been optically modulated by the image display device onto a screen. The second optical system is configured to pass again the rays that have been output from the image display device, and to make the rays enter the projection lens. ... Fujifilm Corporation

09/24/15 / #20150268452

Imaging lens and imaging apparatus

An imaging lens substantially consists of a first lens-group, a stop and a second lens-group in this order from an object-side. The first lens-group substantially consists of three or less lenses including at least one negative lens and a positive lens. ... Fujifilm Corporation

09/24/15 / #20150267162

Method of collecting seed algae from microalgae on liquid surface and of performing culturing in separate culture container, in method of culturing microalgae on liquid surface

There is provided a method of culturing microalgae, including: culturing in a first stage in which microalgae obtained through a purification process are cultured in a culture solution within a first culture container to form a biofilm as a film-like structure or a three-dimensional structure which is formed of the microalgae on a liquid surface of the culture solution; and culturing in a second stage in which microalgae are cultured on a liquid surface using at least a part of the biofilm as a film-like structure or a three-dimensional structure which is formed on the liquid surface of the culture solution, as seed algae.. . ... Fujifilm Corporation

09/24/15 / #20150267112

Etching composition

This disclosure relates to etching compositions containing 1) at least one oxidizing agent; 2) at least one chelating agent; 3) at least one metal corrosion inhibitor; 4) at least one organic solvent; 5) at least one amidine base; and 6) water.. . ... Fujifilm Corporation

09/24/15 / #20150266840

Fluorine atom-containing mercapto compound

A mercapto compound is represented by formula (1) (in formula (1), r1 and r2 each independently represent a hydrogen atom or an alkyl group; r3 and r4 each independently represent a hydrogen atom or a substituent; n represents 1 or 2; m represents an integer of 1 to 6; 1 represents an integer of 1 to 6; q represents 0 or 1; p represents 2 or 3; p+q represents 3; x represents a perfluoroalkyl group having 1 to 14 carbon atoms; when n is 2, structures of units represented by cr1r2 may be identical to or different from each other; and when m is 2 or more, structures of units represented by cr3r4 may be identical to or different from each other). The mercapto compound is novel and has excellent affinity for a fluorine-containing polymer and a fluorine-containing solvent.. ... Fujifilm Corporation

09/24/15 / #20150266826

Sulfate of 5-hydroxy-1h-imidazole-4-carboxamide

Sulfate of 5-hydroxy-1h-imidazole-4-carboxamide has such characteristics as suppressed blue coloring, high purity, low hygroscopic property, and superior storage stability, and thus is useful as an active pharmaceutical ingredient of drugs.. . ... Fujifilm Corporation

09/24/15 / #20150265964

Gas separation composite membrane, gas separation module, gas separation apparatus, gas separation method, and method of producing gas separation composite membrane

A gas separation composite membrane, containing a gas permeable supporting layer, and a gas separating layer containing a crosslinked polyimide resin above the gas permeable supporting layer, in which the crosslinked polyimide resin has a structure in which 2 to 4 molecules of a polyimide compound is coordinated with a divalent to tetravalent central metal via an oxygen atom or a sulfur atom, and when the crosslinked polyimide resin has plural central metals, the plural central metals are linked via the polyimide chain of the polyimide compound; and a gas separating module, a gas separation apparatus and a gas separation method utilizing this gas separation composite membrane.. . ... Fujifilm Corporation

09/24/15 / #20150265186

Breast thickness measuring apparatus, breast thickness measuring method, and radiographic image capturing system

A breast thickness measuring apparatus and a breast thickness measuring method are applied to a radiographic image capturing system. After a breast, which is placed on a support table, has been compressed by a compression plate having a marker disposed thereon, the breast is irradiated with radiation emitted from a radiation source. ... Fujifilm Corporation

09/24/15 / #20150265135

Endoscope

There is provided an endoscope that prevents occurrence of buckling of a flexible body built in an insertion part of the endoscope without damaging other built-in components, and is easy to manufacture without impairing the curving manipulability. The endoscope includes a curvable portion, and an elongated insertion part being inserted into a subject. ... Fujifilm Corporation

09/17/15 / #20150264324

Image processing device, image capture device, image processing method, and image processing program

. . . . . . . . A digital signal processing unit 17 extracts a determination block which includes a predetermined number of pixels and has a pixel to be corrected as the center. When an edge of an object image is present in each determination block, the direction of the edge is a direction perpendicular to a direction in which a phase difference is detected by the phase difference detecting pixel, and the edge overlaps the pixel to be corrected, the digital signal processing unit 17 performs interpolation correction for an output signal from the pixel to be corrected in the block.. ... Fujifilm Corporation

09/17/15 / #20150264257

Imaging system and imaging method

An imaging system using a transmission light source unit includes a sensor unit (imaging unit) that detects light emitted from a light source unit, a storage unit that stores correction data for eliminating the influence of ambient light, and a signal processing unit that performs correction for eliminating the influence of ambient light on measurement data, which is obtained by measurement using a subject, based on the correction data. The correction data is calculated based on a difference between first reference data obtained by imaging in a state where a light shielding plate having an opening is disposed between the light source unit and the sensor unit and second reference data obtained by imaging in a state where no light shielding plate is disposed.. ... Fujifilm Corporation

09/17/15 / #20150264242

Imaging system and imaging method

An imaging system 1 includes an imaging unit configured to capture an image of an object, an input receiving unit, and a calculation unit configured to change an exposure time calculation method for calculating an exposure time required for a main imaging operation according to an imaging mode input to the input receiving unit and to calculate the exposure time with the changed exposure time calculation method. The imaging unit captures the image of the object at the exposure time calculated by the calculation unit.. ... Fujifilm Corporation

09/17/15 / #20150264231

Support plate for solid-state imaging element, method for manufacturing the same , and solid-state imaging device

A solid-state imaging device comprises an image sensor, a circuit board, a support plate, an ir cut filter, a taking lens, a lens holder, and a support barrel. The image sensor is mounted on the circuit board. ... Fujifilm Corporation

09/17/15 / #20150262607

Optical information recording medium and method for manufacturing same

The object of the invention is to provide an optical information recording medium which excels in stability e.g., for preserving the properties during a long-term storage and which enables recording using a laser having a small peak power, and a method for manufacturing such an optical information recording medium. An optical information recording medium 10 includes a recording layer 14, and intermediate layers (adhesive agent layer 15a and recording layer support layer 15b) adjacent to the recording layer 14, and the recording layer 14 includes a recording material comprising a one-photon absorption dye bound to a polymer binder (polymer compound).. ... Fujifilm Corporation

09/17/15 / #20150262427

Augmented reality provision system, method, and non-transitory computer readable medium

Provided are an augmented reality provision system, a method, and a non-transitory computer readable medium capable of displaying a virtual object in a very natural representation form regardless of a state of an illumination in a real space. A plurality of same color patches with the same color are extracted from a captured image including a target. ... Fujifilm Corporation

09/17/15 / #20150262026

Image processing apparatus, and operation method and program therefor

For assigning a binary label representing belonging to a target region or not to each pixel in an image: a predicted shape of the target region is set; a pixel group including n pixels is selected, where n is a natural number of 4 or more, which have a positional relationship representing the predicted shape; and an energy function is set, which includes an n-th order term in which a variable is a label of each pixel of the pixel group, so that a value of the n-th order term is at a minimum value when a combination of the labels assigned to the pixels of the pixel group is a pattern matching the predicted shape, and increases in stages along with an increase in a number of pixels to which a label different from the pattern is assigned. The labeling is performed by minimizing the energy function.. ... Fujifilm Corporation

09/17/15 / #20150261994

Image processor, important person determination method, image layout method as well as program and recording medium

An image processor is provided which is configured to detect face images from a plurality of image data, to perform same person determination processing based on the detected face images to classify the face images into image groups each including face images of a single person, thereby identifying persons corresponding to the respective image groups, to determine at least one person as a main person from among the identified persons, and to determine at least one person highly related to the main person as an important person from among persons except the main person.. . ... Fujifilm Corporation

09/17/15 / #20150260964

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is constituted essentially by six lenses, including: a first lens of a biconvex shape; a second lens having a negative refractive power; a third lens having a positive refractive power and is of a meniscus shape with a convex surface toward the object side; a fourth lens having a positive refractive power; a fifth lens having a negative refractive power; and a sixth lens having a negative refractive power and a concave surface toward the image side, provided in this order from the object side. The imaging lens satisfies a predetermined conditional formula.. ... Fujifilm Corporation

09/17/15 / #20150260961

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is constituted essentially by six lenses, including: a first lens having a positive refractive power and a convex surface toward the object side; a second lens having a negative refractive power; a third lens having a positive refractive power; a fourth lens having a positive refractive power; a fifth lens of a biconcave shape; and a sixth lens having a negative refractive power, provided in this order from the object side. The imaging lens satisfies predetermined conditional formulae.. ... Fujifilm Corporation

09/17/15 / #20150260954

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is constituted essentially by six lenses, including: a first lens having a positive refractive power and is of a meniscus shape with a convex surface toward the object side; a second lens having a negative refractive power; a third lens; a fourth lens having a positive refractive power; a fifth lens having a negative refractive power and a concave surface toward the image side; and a sixth lens of a biconcave shape, provided in this order from the object side. The imaging lens satisfies a predetermined conditional formula.. ... Fujifilm Corporation

09/17/15 / #20150260953

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is constituted essentially by six lenses, including: a first lens having a positive refractive power; a second lens having a negative refractive power; a third lens; a fourth lens having a positive refractive power; a fifth lens of a biconcave shape; and a sixth lens of a biconcave shape, provided in this order from the object side. The imaging lens satisfies a predetermined conditional formula.. ... Fujifilm Corporation

09/17/15 / #20150260886

Ir cut filter, method for manufacturing the same, and solid-state imaging device

A solid-state imaging device comprises a cmos sensor, a circuit board, a ceramic plate, an ir cut filter, a taking lens, a lens holder, and a support barrel. The cmos sensor is mounted on the circuit board. ... Fujifilm Corporation

09/17/15 / #20150260885

Composition, infrared transmission filter and method for manufacturing the same, and infrared sensor

There is provided a composition, wherein when a film is formed to have a film thickness of 1 μm, light transmittance in a thickness direction of the film has a maximum value of 20% or less at a wavelength in a range of 400 to 750 nm, and light transmittance in a thickness direction of the film has a minimum value of 90% or more at a wavelength in a range of 900 to 1,300 nm, and an infrared transmission filter formed with the composition, a method for manufacturing an infrared transmission filter, and an infrared sensor comprising the infrared transmission filter.. . ... Fujifilm Corporation

09/17/15 / #20150260852

Radiographic image capture device, method and program storage medium

A radiographic image capture device includes a radiation detector and a determination section. The radiation detector includes a first sensor for radiographic image capture and a second sensor for radiation detection. ... Fujifilm Corporation

09/17/15 / #20150259547

Curable resin composition, production method of image sensor chip using the same, and image sensor chip

There is provided a curable resin composition which is capable of being coated so as to have a film thickness of 20 μm or more and contains a dye having a maximum absorption wavelength in a wavelength range from 600 to 850 nm, and the infrared ray cut filter having a dye-containing layer having a film thickness of 20 μm or more formed from the curable resin composition, and a production method of image sensor chip comprising a step of coating the curable resin composition on a glass substrate to form a dye-containing layer, and a step of adhering the glass plate having the dye-containing layer formed on a solid-state imaging device substrate.. . ... Fujifilm Corporation

09/17/15 / #20150259227

Functional polymer membrane and method of producing the same

A functional polymer membrane having a pore volume fraction of 0.6% or more and 3.0% or less by allowing a reaction of curing a composition containing a polymerizable compound (a) and a copolymerizable monomer (b).. . ... Fujifilm Corporation

09/17/15 / #20150258505

Gas separation membrane, gas separation module, gas separation apparatus, and gas separation method

A gas separation membrane having a gas separating layer containing a polybenzoxazole resin, in which the polybenzoxazole exhibits a solubility of 1% by mass or more to any one solvent selected from tetrahydrofuran, chloroform, methyl ethyl ketone, and n-methylpyrrolidone, at a temperature of 30° c., a gas separation module utilizing the gas separation membrane, a gas separation apparatus, and a gas separation method.. . ... Fujifilm Corporation

09/17/15 / #20150257734

High frequency ultrasound transducer having an ultrasonic lens with integral central matching layer

High frequency ultrasound transducers configured for use with high frequency ultrasound diagnostic imaging systems are disclosed herein. In one embodiment, an ultrasound transducer includes a concave lens having an average thickness in a center portion that that is substantially equal to an odd multiple a ¼-wavelength of the center frequency of the ultrasound transducer.. ... Fujifilm Corporation

09/17/15 / #20150257730

Medical image display apparatus, method, and medium

Scanning a subject with an ultrasonic probe and obtaining an ultrasonic image of the subject. Obtaining a cross-sectional image of a cross-section of a three-dimensional image corresponding to the ultrasonic image from the three-dimensional image, the three-dimensional image including a puncture line set for a puncture needle and a superimposed columnar index having a central axis line on the puncture line and opacity which is reduced with the distance from the central axis line. ... Fujifilm Corporation

09/17/15 / #20150257723

Radiation imaging apparatus

A cassette holder of an imaging stand is provided with first and second catch members for catching and holding an electronic cassette from above and below. The first catch member has a multi connector connected to a multi terminal of the electronic cassette. ... Fujifilm Corporation

09/10/15 / #20150257245

Radiographic imaging system, method of controlling radiographic imaging system and recording medium storing program of controlling radiographic imaging system

. . A radiographic imaging system that includes: a radiation detector including an imaging region in which a plurality of pixels are provided, each pixel including a sensor portion that generates charges in accordance with radiation amounts of irradiated radiation and accumulates the generated charges during an accumulation period, and a switching element that reads out the charges from the sensor portion after the accumulation period; an imaging control section that images a radiographic image by sequentially imaging radiographic images during the accumulation period using division regions, into which the imaging region of the radiation detector is plurally divided, one at a time; and a display control section that displays, at a display section, information relating to remaining imaging until the imaging is complete, the information representing a state of progress of the imaging by the imaging control section.. . ... Fujifilm Corporation

09/10/15 / #20150256792

Imaging apparatus and focus control method

It is intended to provide an imaging apparatus and a focus control method that can prevent af speed reduction even at the occurrence of a flicker. A system control unit 11 of a digital camera having a solid-state imaging device 5 that shoots a subject via an imaging lens 1 including a focus lens selectively performs one of a first focus control for controlling the focus lens so as to move it to a focus position by a phase difference af method and a second focus control for controlling the focus lens so as to move it to a focus position by a contrast af method. ... Fujifilm Corporation

09/10/15 / #20150256738

Imaging apparatus and exposure determining method

It is intended to provide an imaging apparatus that enables proper exposure of phase difference detection pixels and thereby makes it possible to perform phase difference autofocusing with high accuracy. A system control unit 11 selects phase difference detection pixels from phase difference detection pixels 51r and 51l existing in a selected phase difference detection area 52 according to a position of the selected phase difference detection area 52 in a row direction x, and determines exposure conditions based on output signals of the selected phase difference detection pixels. ... Fujifilm Corporation

09/10/15 / #20150256718

Image sensing apparatus and method of controlling operation of same

A subject is imaged repeatedly and color images of the subject are obtained. A color histogram is generated from the color subject image obtained and a representative color is decided from the color histogram generated. ... Fujifilm Corporation

09/10/15 / #20150255636

Radiation detector

A radiation detector (10) which has a multilayer structure that includes: a first electrode (34); a second electrode (49) that is disposed so as to face the first electrode; a selenium layer (48) that is disposed between the first electrode and the second electrode and contains amorphous selenium; a first blocking organic layer (38) that is adjacent to the selenium layer, between the first electrode and the selenium layer, and that contains a hole transport material having an electron affinity of 3.7 ev or less; and a second blocking organic layer (37) that is adjacent to the selenium layer, between the second electrode and the selenium layer, and that contains an electron transport material having an ionization potential of 5.9 ev or more. This radiation detector (10) has low dark current, excellent durability, and less afterimages.. ... Fujifilm Corporation

09/10/15 / #20150255309

Etching method of semiconductor substrate, and method of producing semiconductor device

An etching method containing the step of processing a substrate having a first layer containing titanium nitride (tin) and a second layer containing a transition metal by bringing an etching liquid into contact with the substrate and thereby removing the first layer, wherein the first layer has a surface oxygen content from 0.1 to 10% by mole, and wherein the etching liquid comprises an ammonia compound and an oxidizing agent, and has a ph of from 7 to 14.. . ... Fujifilm Corporation

09/10/15 / #20150254430

Medical test result display device and method for operating the same

A medical test result display device and an operating method thereof are provided. An integration server reads out medical information from a medical case db on the basis of a patient id of a delivery request. ... Fujifilm Corporation

09/10/15 / #20150253673

Pattern forming method, resist pattern formed by the method, method for manufacturing electronic device using the same, and electronic device

There is provided a pattern forming method including (1) forming a film by an actinic ray-sensitive or radiation-sensitive resin composition containing a resin (a) capable of increasing the polarity by the action of an acid so that a solubility thereof in a developer containing an organic solvent is decreased, (2) exposing the film, (3) developing the film by a developer including an organic solvent to form a negative pattern having a space part obtained by removing a part of the film and a residual film part which is not removed by the developing, (4) forming a resist film for reversing a pattern, on the negative pattern, so as to be embedded in the space part in the negative pattern, and (5) reversing the negative pattern into a positive pattern by removing the residual film part in the negative pattern by using an alkaline wet etching liquid.. . ... Fujifilm Corporation

09/10/15 / #20150253662

Actinic ray-sensitive or radiation-sensitive resin composition, method for forming pattern, resist film, method for manufacturing electronic device, and electronic device

According to an exemplary embodiment of the present invention, there is provided an actinic ray-sensitive or radiation-sensitive resin composition includes an aromatic group and a resin (a) that may include (i) a repeating unit having a group capable of decomposing by the action of an acid to generate a polar group and (ii) a repeating unit having a polar group other than a phenolic hydroxyl group, wherein the total content of the repeating units (i) and (ii) is 51 mol % or more based on the entire repeating units in the resin (a).. . ... Fujifilm Corporation

09/10/15 / #20150253648

Imaging device, focusing method thereof, and non-transitory computer readable medium

An imaging device, includes: an imaging element including imaging pixels and phase difference detecting pixels, a calculating unit which calculates numerical information corresponding to a defocus amount using an image signal obtained by imaging by the phase difference detecting pixels whenever the imaging is performed by the imaging element, a difference calculating unit calculating with respect to at least three times of imaging which is continuously performed, a difference between the numerical information obtained by arbitrary imaging and the numerical information obtained by the imaging which is continuously performed after the arbitrary imaging, and a control unit which moves a focus lens to a focus position using the obtained numerical information when a variance of the obtained differences is smaller than a threshold value and controls a position of the focus lens not to be changed when the variance is equal to or larger than the threshold value.. . ... Fujifilm Corporation

09/10/15 / #20150253591

Dye composition for electrowetting display and electrowetting display device

A dye composition for an electrowetting display, comprising: an ether-based nonpolar solvent having a relative dielectric constant of 5 or less; and a dye at a content of 10% by mass or more with respect to a total mass of the dye composition.. . ... Fujifilm Corporation

09/10/15 / #20150253547

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is constituted essentially by six lenses, including: a first lens having a positive refractive power and a convex surface toward the object side; a second lens having a negative refractive power; a third lens having a positive refractive power and a convex surface toward the image side; a fourth lens having a positive refractive power; a fifth lens having a positive refractive power; and a sixth lens having a negative refractive power, provided in this order from the object side. The imaging lens satisfies a predetermined conditional formula.. ... Fujifilm Corporation

09/10/15 / #20150253546

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is constituted essentially by six lenses, including: a first lens having a positive refractive power and a convex surface toward the object side; a second lens having a negative refractive power and a concave surface toward the object side; a third lens having a positive refractive power; a fourth lens having a negative refractive power; a fifth lens having a positive refractive power; and a sixth lens having a negative refractive power, provided in this order from the object side. The imaging lens satisfies a predetermined conditional formula.. ... Fujifilm Corporation

09/10/15 / #20150253479

Polarizing plate and liquid crystal display device including the same

A polarizing plate includes at least: a polarizer layer containing a polyvinyl alcohol-based film dyed with iodine; and one or more other layers except for the polarizer layer, in which the polarizer layer contains a compound which has polyiodide ion i5− reduction capability in iodide compound- and iodine-containing solutions, and at least one of the one or more other layers contain a compound which has polyiodide ion i5− formation capability in an iodide compound-containing solution.. . ... Fujifilm Corporation

09/10/15 / #20150253466

Antireflection film, polarizing plate, image display device and a manufacturing method for antireflection film

There is provided an antireflection film having a surface haze of less than 1.0%, including: a light transmitting layer; and an antireflection layer, wherein the antireflection layer includes a specific unevenness structure on a surface at a side opposite to a side at which the light transmitting layer is provided, the specific unevenness structure made from specific raw materials.. . ... Fujifilm Corporation

09/10/15 / #20150253441

Portable radiographic image capturing apparatus and casing

A portable radiographic image capturing apparatus includes a casing having a front face including a top plate and a rear face. The rear face is fitted in the front face such that second sides of the rear face are disposed inside of first sides of the front face. ... Fujifilm Corporation

09/10/15 / #20150253436

Portable radiographic image capturing apparatus

A portable radiographic image capturing apparatus includes a radiation conversion panel configured to output image information on the basis of applied radiation, a casing housing the radiation conversion panel therein, and a plurality of support members on which the radiation conversion panel is supported in the casing. The support members have slot structures housing wires therein.. ... Fujifilm Corporation

09/10/15 / #20150252311

Cleaning composition, cleaning process, and process for producing semiconductor device

A cleaning composition for removing plasma etching residue and/or ashing residue formed above a semiconductor substrate is provided that includes (component a) water, (component b) a hydroxylamine and/or a salt thereof, (component c) a basic organic compound, and (component d) an organic acid and has a ph of 7 to 9. There are also provided a cleaning process and a process for producing semiconductor device employing the cleaning composition.. ... Fujifilm Corporation

09/10/15 / #20150252178

Cellulose acylate film, polarizing plate protective film, polarizing plate and liquid crystal display using the same

A cellulose acylate film, containing: at least two or more of chelating agents having different pka values from one another, wherein the chelating agents comprise: a chelating agent a having at least one functional group whose acid dissociation constant pka, measured at 25° c. In a mixed solvent having a mixing ratio of tetrahydrofuran 60 ml/water 40 ml, is 6 or less; and a chelating agent b having at least one functional group of a conjugate acid whose pka, measured at the same condition, is 7 or more; and a cellulose acylate, and wherein the number of bright spots of the cellulose acylate film is equal to or less than 500/cm2; a polarizing plate protective film, a polarizing plate and a liquid crystal display using the same.. ... Fujifilm Corporation

09/10/15 / #20150251393

Transfer film, transparent laminate, method for producing transfer film, method for producing transparent laminate, capacitive input device, and image display device

A transfer film has a temporary support, a first curable transparent resin layer, a second curable transparent resin layer which is disposed adjacent to the first curable transparent resin layer in this order. The refractive index of the second curable transparent resin layer is higher than the refractive index of the first curable transparent resin layer and equal to or greater than 1.6.. ... Fujifilm Corporation

09/10/15 / #20150251018

Radiation image processing apparatus, method, and medium

In a radiation image processing apparatus, method, and program, performing image processing based on scattered radiation, such as scattered radiation elimination processing, accurately by taking into account the influence of scattered radiation from an area adjacent to a processing target area. For this purpose, performing image processing on a radiation image captured by applying radiation to a subject based on scattered radiation generated by the subject. ... Fujifilm Corporation

09/10/15 / #20150250440

Radiographic imaging system, radiographic imaging method and non-transitory recording medium

An estimated exposure dose calculator calculates an estimated exposure dose, which is an estimate of an exposure dose of a subject by irradiation of radiation, on the basis of the image capturing conditions after the image capturing conditions are set and prior to the radiation imaging. An exposure dose output unit outputs the calculated estimated exposure dose to the outside.. ... Fujifilm Corporation

09/03/15 / #20150248056

Pattern forming method, multi-layered resist pattern, multi-layered film for organic solvent development, resist composition, method for manufacturing electronic device, and electronic device

. . . . . . . . A pattern forming method contains: (i) a step of forming a first film on a substrate by using a first resin composition (i), (ii) a step of forming a second film on the first film by using a second resin composition (ii) different from the resin composition (i), (iii) a step of exposing a multi-layered film having the first film and the second film, and (iv) a step of developing the first film and the second film in the exposed multi-layered film by using an organic solvent-containing developer to form a negative pattern.. . ... Fujifilm Corporation

09/03/15 / #20150247996

Zoom lens and imaging apparatus

A zoom lens consists of a positive first lens group, a negative second lens group moved from the object side to the image plane side during zooming from the wide angle end to the telephoto end, a positive third lens group moved during zooming, and a positive fourth lens group, in order from the object side. The second and third lens groups each pass through a point where the imaging magnification of each corresponding lens group is −1× at the same time during zooming from the wide angle end to the telephoto end. ... Fujifilm Corporation

09/03/15 / #20150247994

Macro lens system and imaging apparatus

A macro lens system includes, in this order from an object side: a positive first lens group; a negative second lens group; a positive third lens group; a negative fourth lens group; a positive fifth lens group; and a negative sixth lens group. The first lens group is constituted by three lenses. ... Fujifilm Corporation

09/03/15 / #20150247936

Radiographic imaging device

In the radiographic imaging device, a portion of a second effective imaging region at a first side or a second side of a sensor unit of a second radiation detection panel, and a portion of a first effective imaging region at a third side or a fourth side of the sensor unit of a first radiation detection panel, are overlapped in a radiation irradiating direction. A portion of a second effective imaging region at the third side or the fourth side of the sensor unit of the second radiation detection panel, and a portion of a third effective imaging region at the third side or the fourth side of the sensor unit of the third radiation detection panel, are overlapped in the radiation irradiating direction. ... Fujifilm Corporation

09/03/15 / #20150247087

Etching liquid for semiconductor substrate, etching method using the same, and method of producing semiconductor device

An etching liquid that processes a substrate having a first layer containing titanium nitride (tin) and a second layer containing a transition metal and thereby removes selectively the first layer, wherein the etching liquid contains a fluorine-containing compound, an oxidizing agent and an organic silicon compound.. . ... Fujifilm Corporation

09/03/15 / #20150247048

Coloring composition, ink for inkjet recording using the coloring composition, method for inkjet recording using the ink for inkjet recording, ink cartridge, and inkjet recording material

In accordance with an embodiment of the present invention, there is provided a coloring composition comprising, for example, a compound (1a), for example, a compound (2b), and at least one preservative.. . ... Fujifilm Corporation

09/03/15 / #20150246556

Image recording apparatus and method, and varnish application device and method

The present invention provides an image recording apparatus and method, and a varnish application device and method, which can ensure the adhesiveness of the varnish that has been applied onto the surface of the image. An image recording method according to an aspect of the present invention includes: comparing an attained temperature t1 (attained temperature t1 when ink has been dried) of the surface of the image on the medium when the ink has been dried, with a melting point tw of the wax component contained in the ink; and heating the surface of the image before the varnish that has been applied in the varnish application step is cured in the varnish curing step, when t1≧tw holds.. ... Fujifilm Corporation

09/03/15 / #20150245808

Radiographic imaging system, radiographic imaging device, radiographic imaging device control method, and program storage medium

A radiographic imaging system includes plural radiographic imaging devices that image a same subject. The radiographic imaging device includes: a radiation detector; a detection unit that detects whether or not application of the radiation has been started based on electrical signals indicating detection results of sensors that detect the application of the radiation and that are disposed in correspondence to the radiation detector; a determination unit that determines whether or not noise is superimposed on the electrical signals after the detection unit has detected whether or not the application of the radiation has been started; and a communication unit that is connected to another radiographic imaging device and transmits to and receives from the other connected radiographic imaging device a detection result signal indicating the detection result of the detection unit and a determination result signal indicating the determination result of the determination unit.. ... Fujifilm Corporation

09/03/15 / #20150245807

Radiation image capture device and radiation image capture system

A radiation image capture device includes plural radiation detection panels that each detect incident radiation that has passed through an imaging subject, that each generate a radiation image, and that are disposed in a row in a direction orthogonal to the radiation incident direction. The radiation image capture device designates a display target image from out of plural radiation images respectively generated by the plural radiation detection panels, and transmits the designated display target image to a console. ... Fujifilm Corporation

09/03/15 / #20150245805

Radiographic imaging device and computer readable medium

The radiographic imaging device including: a radiation detector comprising plural radiographic image acquisition pixels, which are arranged in a matrix in an imaging region, for capturing a radiographic image and that acquire image information representing the radiographic image by converting applied radiation into electric charges and storing the electric charges, and a plural radiation detection pixels that detect the applied radiation by converting the applied radiation into electric charges and storing the electric charges, a subset of the plural radiation detection pixels having different characteristics; and a detecting unit that uses the radiation detection pixels selectively according to the different characteristics to detect a state of application of the radiation.. . ... Fujifilm Corporation

09/03/15 / #20150245763

Rigid endoscope with hermetic seal

A rigid endoscope includes an imaging module and a hermetic shell for containing the imaging module. A connecting line is contained in the hermetic shell, and has first and second ends. ... Fujifilm Corporation

08/27/15 / #20150245479

Process for manufacturing conductive film and printed wiring board

. . . . . . . . . . The process for manufacturing a conductive film, said process being capable of achieving efficient progress of reduction of a metal oxide into a metal and yielding a conductive film which exhibits excellent adhesion to a substrate; and a printed wiring board. This process includes: a step for applying a dispersion which contains metal oxide particles to a substrate to form a precursor film which contains the particles; and a step for irradiating the precursor film with a continuous-wave laser beam while scanning the laser beam relatively, and thereby reducing the metal oxide in an irradiated area to form a metal-containing conductive film. ... Fujifilm Corporation

08/27/15 / #20150245456

Radiographic image capturing apparatus and method for supplying electric power thereto

A radiographic image capturing apparatus includes a mobile cart unit, a plurality of devices used for capturing a radiographic image, and an electric power supply activator enabling supply of electric power between the devices, based on an instruction of permission to supply electric power.. . ... Fujifilm Corporation

08/27/15 / #20150245009

Camera system, color conversion device and method employed thereupon, and recording medium for color conversion program

A camera system includes: a database which stores a plurality of stereoscopic color profiles, in which conversion relationships calculated from second image data obtained by photographing a plurality of reference color stereoscopic objects assigned with reference colorimetric values in advance and the reference colorimetric values corresponding to the second image data are associated with a plurality of illumination conditions in photographing; a selection unit which, based on an illumination condition at the time of photographing of a stereoscopic subject, selects a stereoscopic color profile corresponding to the illumination condition; and a color conversion unit which performs color conversion from first image data of a photographed image of the stereoscopic subject to colorimetric values, based on the selected stereoscopic color profile.. . ... Fujifilm Corporation

08/27/15 / #20150245002

Endoscope system and operating method thereof

A light source unit emits multi-colored light. The amount of light of each color is controlled so that the multi-colored light has a first light emission ratio. ... Fujifilm Corporation

08/27/15 / #20150244955

Image capture device, image processing method, and program

According to the present invention, provided is an image capture device, an image processing method, and a non-transitory computer readable medium storing a program capable of detecting a direction of incidence of abnormal oblique incident light and reducing an effect of color mixture caused by the abnormal oblique incident light. An image capture device 10 includes an abnormal oblique-incident-light detection portion 34 and a correction portion 36. ... Fujifilm Corporation

08/27/15 / #20150244926

Imaging device, defocus amount calculating method, and imaging optical system

The camera main body 200 stores sensitivity ratio data indicating a sensitivity ratio of a pixel 51r in the position and an imaging pixel 51 which is adjacent to the pixel 51r and a sensitivity ratio of a pixel 51l in the position and a pixel 51 which is adjacent to the pixel 51l, for every information of the different incident light ray angles in the arbitrary position of a light receiving surface 50 in an x direction. The system control unit 11 obtains information of the incident light ray angle in two positions on the light receiving surface 50 corresponding to the set optical condition and corrects the level difference of the output signals of the pixels 51r and 51l using the sensitivity ratio data corresponding to the obtained incident light ray angle.. ... Fujifilm Corporation

08/27/15 / #20150244925

Image processing device, imaging device, image processing method, and computer readable medium

The image acquisition section acquires a first image and a second image output from an image pick-up device. A parallax computation section computes parallax indicating the amount of displacement between each of the pixels in the first image and corresponding pixels in the second image acquired by the image acquisition section. ... Fujifilm Corporation

08/27/15 / #20150243527

Etching method of semiconductor substrate, and method of producing semiconductor device

An etching method containing, at the time of processing a substrate having a first layer containing titanium nitride (tin) and a second layer containing a transition metal, selecting a substrate in which a surface oxygen content of the first layer is from 0.1 to 10% by mole, and applying an etching liquid containing a hydrofluoric acid compound and an oxidizing agent to the substrate and thereby removing the first layer.. . ... Fujifilm Corporation

08/27/15 / #20150243055

Image display device and method, and medium containing program

A two-dimensional image is generated from a three-dimensional volume image of the chest of a human body based on information about recognized and labeled costal regions and vertebral regions. The two-dimensional image includes first regions showing one of right and left costal regions and second regions showing the other of the right and left costal regions or vertebral regions. ... Fujifilm Corporation

08/27/15 / #20150241687

Light source device for endoscope system

A light source device for an endoscope system comprises a light source unit, which collects light with a lens and allows the collected light to enter a light guide provided to an endoscope. The light source device comprises a receiving unit and a lens barrel (movable unit). ... Fujifilm Corporation

08/27/15 / #20150241674

Zoom lens and imaging apparatus

A zoom lens consists essentially of, in order from the object side: a positive first lens group that is fixed during magnification change; a moving lens group consisting of at least two lens groups that are moved along the optical axis direction to change an air space therebetween during magnification change; a stop; and a positive end lens group that is fixed during magnification change. The first lens group consists of, in order from the object side, a negative first lens-group front group, a positive first lens-group middle group, and a positive first lens-group rear group. ... Fujifilm Corporation

08/27/15 / #20150241673

Zoom lens and imaging apparatus

A zoom lens consists essentially of, in order from the object side, a positive first lens group, a positive second lens group, a negative third lens group, a negative fourth lens group, and a positive fifth lens group. During magnification change from the wide-angle end to the telephoto end, the first lens group and the fifth lens group are fixed relative to the image plane, and the second lens group, the third lens group, and the fourth lens group are moved along the optical axis direction to change distances between the lens groups.. ... Fujifilm Corporation

08/27/15 / #20150241567

Radiation image detecting device and operating method thereof

To provide a radiation image detecting device providing high responsivity and high precision of an emission start judgment, an electronic cassette has a panel unit and a control unit. The panel unit has a two-dimensional array of normal pixels for accumulating signal charge upon receiving x-rays and detection pixels for detecting the x-rays. ... Fujifilm Corporation

08/27/15 / #20150241003

Fluorescence imaging apparatus and light source unit thereof

A light source unit has two or more types of emission units which apply excitation light of three colors (blue, green, and red). The emission units share a single circuit board. ... Fujifilm Corporation

08/27/15 / #20150240096

Coloring composition, ink for inkjet recording, method for inkjet recording, inkjet printer cartridge, and inkjet recording material

According to the present invention, there is provided a coloring composition comprising, for example, a compound (1a), for example, a compound (2b), and, for example, a compound (3a).. . ... Fujifilm Corporation

08/27/15 / #20150238743

Molding compact, and manufacturing method for transdermal absorption sheet

A molding compact for forming a transdermal absorption sheet on which a needle-shaped protruding part is arranged is a molding compact that is a laminate of: a first member having a needle-shaped recessed part formed on a front surface thereof, the needle-shaped recessed part being an inverse of the needle-shaped protruding part; a second member provided on a back surface of the first member, the second member being composed of a waterproof and moisture-permeable material; and a third member provided on a back surface of the second member, the third member being composed of a rigid body. Provided are a molding compact that makes it possible to prevent leakage of a drug-containing solution filled into the needle-shaped recessed part, and a manufacturing method for a transdermal absorption sheet using the molding compact.. ... Fujifilm Corporation

08/27/15 / #20150238434

Transdermal absorption sheet, and manufacturing method for the same

A transdermal absorption sheet and a manufacturing method for the transdermal absorption sheet includes a laminating step of forming a multilayer film with a viscosity difference by forming, on a support, a lower layer containing a first transdermal absorption material and an upper layer containing a drug and a second transdermal absorption material and having a lower viscosity than the lower layer, a filling step of filling needle-like recessed portions corresponding to inverted needle-like protruding portions with a solution of the transdermal absorption material by pressing a mold in which the needle-like recessed portions are arranged in a two-dimensional array, against a surface of the multilayer film supported by the support to allow the multilayer film to flow, a solidifying step of solidifying the multilayer film with the mold pressed against the surface of the multilayer film, and a peeling-off step of peeling the solidified multilayer film from the mold.. . ... Fujifilm Corporation

08/27/15 / #20150238413

Method for manufacturing transdermal-absorption sheet

A method is provided which enables a drug to be concentrated at needle-like protruding portions and which further allows transdermal-absorption sheets to be manufactured at high production efficiency. The method repeats a step of feeding a drug-containing solution from a liquid feeding apparatus to a mold and filling needle-like recessed portions with the drug-containing solution through a nozzle aligned over the needle-like recessed portions in a state where the nozzle and a front surface of the mold are brought into contact with each other, and a step of moving the liquid feeding apparatus relative to the mold in a state where the nozzle and the front surface of the mold are brought into contact with each other. ... Fujifilm Corporation

08/27/15 / #20150238127

Endoscope system, endoscope system processor device, operation method for endoscope system, and operation method for endoscope system processor device

The endoscope system includes: an image signal acquisition unit acquiring first image signal in first wavelength range where the amount of light absorption changes according to the concentration of yellow dye, second image signal in second wavelength range where the amount of light absorption changes according to the blood volume of an observation target, and third image signal in third wavelength range where a change in the amount of light absorption according to the concentration of the yellow dye is smaller than the first wavelength range and a change in the amount of light absorption according to the blood volume is smaller than the second wavelength range; a signal ratio calculation unit calculating first signal ratio based on the first and second image signals and calculating second signal ratio based on the second and third image signals; and a warning notification unit calculating a threshold value and generates warning signal.. . ... Fujifilm Corporation

08/27/15 / #20150238126

Endoscope system, endoscope system processor device, operation method for endoscope system, and operation method for endoscope system processor device

The endoscope system includes: an image signal acquisition unit acquiring b1 image signal corresponding to blue narrow band where the amount of light absorption changes according to the oxygen saturation of blood hemoglobin, g2 image signal corresponding to green wavelength band where the amount of light absorption changes according to a blood volume of an observation target, r2 image signal corresponding to red wavelength band where a change in the amount of light absorption with respect to the oxygen saturation or the blood volume is small compared with the b1 and g2 image signal, and b2 image signal corresponding to a wavelength band, a difference between a center wavelength of the wavelength band and a center wavelength of the blue narrow band being 20 to 100 nm; and an oxygen saturation calculation unit calculating the oxygen saturation based on the b1, g2, r3, and b2 image signal.. . ... Fujifilm Corporation

08/27/15 / #20150238086

Endoscope system, endoscope system processor device, operation method for endoscope system, and operation method for endoscope system processor device

An exposure amount designation value calculation unit calculates an exposure amount designation value for designating the amount of exposure, which is required to image an observation target, based on an image signal. A threshold value calculation unit calculates a threshold value for comparison with the pixel value of the image signal according to the exposure amount designation value. ... Fujifilm Corporation

08/20/15 / #20150237723

Conductive sheet, usage method of conductive sheet and capacitive type touch panel

. . . . Disclosed are a conductive sheet, a usage method of the conductive sheet and a capacitive type touch panel. For a first conductive sheet, two or more conductive first large grids are formed atop a first transparent base, wherein each first large grid is constituted by combining two or more small grids, and the shapes of facing sides of each first large grid are formed to alternate. ... Fujifilm Corporation

08/20/15 / #20150237273

Image capture device, anomalous oblique incident light detection method, and recording medium

In an aspect of the invention, plural pixels constituting a color image pickup device include a first pair of rb pixels and a second pair of rb pixels both constituted by a red pixel r having a red color filter and a blue pixel b having a blue color filter in a horizontal direction a and vertical direction b, the red pixel and the blue pixel being adjacent to each other. A position of the red pixel r and a position of the blue pixel b are opposite to each other between the first pair of rb pixels and the second pair of rb pixels. ... Fujifilm Corporation

08/20/15 / #20150235613

Medical image display control apparatus and operation method of the same, and medium

Providing a parameter calculation unit that calculates parameters representing medical functional information for pixel positions of the medical image, wherein the upper and lower limit values of the parameter medically represent the same functional information and whose value changes cyclically between these values, an interpolation parameter calculation unit that obtains, for a pixel position for which the parameter is not calculated, a parameter by interpolation, the unit calculating a parameter obtained by the interpolation using a cyclic function in which the interpolation direction differs according to the difference between the parameters calculated for two pixel positions, a display color group storage unit that includes a color group in which the same color corresponds to the upper and lower limit values of the parameter and whose color changes with the magnitude of the parameter, and a mapping unit that maps the parameters based on the color group.. . ... Fujifilm Corporation

08/20/15 / #20150235357

Fluoroscopic image density correction method, non-destructive inspection method, and image processing device

A reference density profile is generated in an outer circumference direction of a pipe having a reference welded portion on the basis of a reference fluoroscopic image generated from a radiation detection medium when a radiation source is disposed on a central axis of the pipe. A weld inspection density profile is generated in an outer circumference direction of a pipe having an inspection target welded portion on the basis of a weld inspection fluoroscopic image. ... Fujifilm Corporation

08/20/15 / #20150234271

Manufacturing method of conductive sheet and conductive sheet

A manufacturing method of a conductive sheet includes: a step a of forming a silver halide-containing photosensitive layer, which contains silver halide, gelatin, and a polymer different from the gelatin and in which a mass ratio (y/x) of a mass y of the polymer to a mass x of the gelatin is equal to or greater than 0.1, on a support; a step b of forming conductive portions containing metal silver by performing exposure and then development treatment on the silver halide-containing photosensitive layer; and a step c of treating the support having the conductive portions with an oxidant which has a standard electrode potential of equal to or greater than +1.5 v and decomposes the gelatin.. . ... Fujifilm Corporation

08/20/15 / #20150234159

Zoom lens for projection and projection-type display apparatus

A zoom lens for projection consists of a negative first lens group, which is fixed during magnification change, a middle group, which includes plural lens groups that move during magnification change, and a positive last lens group, which is fixed during magnification change, in this order from a magnification side. A reduction side is non-telecentric. ... Fujifilm Corporation

08/20/15 / #20150232419

Ketene imine compound, polyester film, back sheet for solar cell module and solar cell module

By forming a polyester film from a polyester resin composition including ketene imine compound represented by the following formula (1) and polyester, the polyester film having excellent hydrolysis resistance in which volatilization of the ketene imine compound or the ketene compound can be suppressed. In formula (1), r1 and r2 represent an alkyl group, an aryl group, an alkoxy group, an alkoxycarbonyl group, an aminocarbonyl group, an aryloxy group, an acyl group, or an aryloxycarbonyl group, and the r1—c(═c)—r2 substructure has a molecular weight of 320 or greater. ... Fujifilm Corporation

08/20/15 / #20150231892

Inkjet recording apparatus and inkjet recording method

An inkjet recording apparatus for forming an image by discharging an ink including an ink pigment and a polymerizable compound containing at least an n-vinyl lactam, in which the 90% diameter in cumulative volume distribution of the particle diameters of the ink pigment is equal to or less than 500 nm and the content of n-vinyl lactam is 3% to 24%, from nozzles of an inkjet head, which includes nozzle arrays having nozzles each of which discharges a curable ink cured by applied active energy and which are arranged in the first direction at a pitch p, the nozzle arrays being n (n≧4) nozzle arrays of every color, which respectively discharge thick inks of at least four colors and which nozzle arrays are arranged to be shifted by p/n away from each other in the first direction.. . ... Fujifilm Corporation

08/20/15 / #20150231575

Method of treating a porous substrate and manufacture of a membrane

Method of treating a substrate (11), comprising: •providing a treatment space (5) between at least two opposing electrodes (2,3), filling the treatment space with a gas composition, •placing the substrate, which is a porous substrate, in the treatment space, generating an atmospheric pressure glow discharge plasma between the at least two opposing electrodes, and •subjecting the porous substrate to the atmospheric pressure glow discharge plasma, thereby creating micro-pores uniformly throughout the porous substrate, •wherein the atmospheric pressure glow discharge plasma in the treatment space has a specific energy of 10 j/cm or higher, and wherein the treatment space comprises oxygen in the range of 0.1 to 21% vol. %. ... Fujifilm Corporation

08/13/15 / #20150230324

Radiation signal processing device, radiation imaging system, and radiation signal processing method

. . A radiation signal processing device including: a reception section that receives as a digital signal a signal representing a detection result from a radiation imaging device that captures an image according to irradiated radiation, and that detects a radiation irradiation amount and outputs the signal representing the detection result; and a conversion section that converts the digital signal representing the detection result received by the reception section into an analogue signal recognizable by a radiation irradiation device that irradiates radiation onto the radiation imaging device and stops radiation irradiation in cases in which radiation has reached a specific irradiation amount.. . ... Fujifilm Corporation

08/13/15 / #20150229847

Image processing device, imaging device, image processing method, and non-transitory computer-readable medium

An image processing device includes an image generation device, a first display device and a second display device, and a display control device, wherein the image generation device generates the first display image and the second display image such that the first display image and the second display image are different in at least any one of decimation ratio, enlargement ratio and reduction ratio of the first display image and the second display image, and the image generation device makes the first display device and the second display device different in at least any one of pixels that are of the first pixel group and the second pixel group and that are used in the generation of the second display image, the enlargement ratio and the reduction ratio of the second display image, and a pixel region in which the second display image is displayed.. . ... Fujifilm Corporation

08/13/15 / #20150229846

Imaging apparatus with display and image display apparatus

A digital camera is provided with a vertically long camera body having an approximately rectangular solid shape. An lcd panel provided in a rear surface of the camera body is arranged such that longitudinal directions of the display screen and the camera body correspond to each other. ... Fujifilm Corporation

08/13/15 / #20150229843

Camera module having anti-shake mechanism

In a camera module for portable electronic equipment, a board holder includes a holder body extending transversely with an optical axis direction, and two support devices extending in the optical axis direction. A main circuit board (first circuit board) of a wiring board device with a flexible wiring board is supported on a rear surface of the holder body. ... Fujifilm Corporation

08/13/15 / #20150229834

Imaging apparatus and its focus control method

It is intended to provide an imaging apparatus capable of selecting a contrast af method immediately if a subject is judged not suitable for a phase difference af method, as well as its focus control method. In an imaging apparatus which switches between a focus control by a phase difference af method and focus control by a contrast af method, whether to perform a focus control according to the phase difference af method is determined according to a color of an image taken in an af area selected from plural af areas 52 that are set in a photodetecting surface 50.. ... Fujifilm Corporation

08/13/15 / #20150228498

Method for manufacturing adhesive film for imprints and method for forming patterns

To obtain a good pattern having a good profile of etched pattern. A method for manufacturing an adhesive film for imprints, the method comprising applying an adhesive composition for imprints in a base, and then rinsing the adhesive composition for imprints.. ... Fujifilm Corporation

08/13/15 / #20150227049

Organic processing liquid for patterning chemical amplification resist film, container for organic processing liquid for patterning chemical amplification resist film, and pattern forming method, method of manufacturing electronic device, and electronic device using the same

According to an exemplary embodiment of the present invention, there are provided an organic treatment solution for patterning chemically amplified resist films, an organic treatment solution containing 1 ppm or less of an alkyl olefin having a carbon number of 22 or less and having a metal element concentration of 5 ppm or less for each of na, k, ca, fe, cu, mg, mn, li, al, cr, ni and zn, a pattern formation method, an electronic device manufacturing method, and an electronic device use the same.. . ... Fujifilm Corporation

08/13/15 / #20150227029

Interchangeable lens camera, camera body, lens unit, and busy signal control method

An aspect of the present invention provides an interchangeable lens camera having a camera body and a lens unit that is freely attachable and detachable to the camera body. In the interchangeable lens camera, a communications unit in the camera body sends via communications terminals (mt_mosi and mt_miso) an intr_busy control instruction that instructs whether to make notification with a busy signal (intr_busy signal) for any operation out of a plurality of types of operations that can be executed, and the lens unit or camera body communications unit sets the busy signal (intr_busy) to an on state (low level) only during the period of operation of the type indicated by the intr_busy control instruction.. ... Fujifilm Corporation

08/13/15 / #20150226957

Dye composition for electrowetting display, method for manufacturing same and electrowetting display device

A method for manufacturing a dye composition for electrowetting display, the method including a processing step of processing a mixture liquid containing a nonpolar solvent and a dye, using an ion exchange resin, to obtain a dye composition for electrowetting display.. . ... Fujifilm Corporation

08/13/15 / #20150226942

Teleconverter lens and imaging apparatus

A teleconverter lens consists essentially of, in order from the object side: a front group having a positive refractive power; and a rear group having a negative refractive power, wherein the front group and the rear group are separated from each other by the widest air space, the front group consists essentially of one positive lens having a convex surface toward the object side, and the rear group includes, in order from the object side, at least one negative lens having a concave surface toward the image side, and at least one positive lens having a convex surface toward the object side.. . ... Fujifilm Corporation

08/13/15 / #20150226939

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is essentially constituted by five lenses, including: a first lens having a positive refractive power and a convex surface toward the object side; a second lens of a biconcave shape; a third lens having a positive refractive power and is of a meniscus shape with a concave surface toward the object side; a fourth lens having a negative refractive power and a concave surface toward the object side; and a fifth lens having a negative refractive power and a concave surface toward the image side, provided in this order from the object side. The imaging lens satisfies predetermined conditional formulae.. ... Fujifilm Corporation

08/13/15 / #20150226881

Antireflection multilayer film

An antireflection multilayer film is formed by alternately laminating high refractive index layers and low refractive index layers having indexes of refraction different from each other. The high refractive index layer is an oblique deposition layer formed by depositing an inorganic material such as tantalum pentoxide onto the surface of an optical element from a diagonal direction, and has minute internal structures composed of slant columnar structures growing along to the deposition direction. ... Fujifilm Corporation

08/13/15 / #20150225645

Etching liquid, etching method using the same, and method of producing semiconductor device

An etching liquid for processing a substrate having a first layer containing titanium nitride (tin) and a second layer containing at least one metal selected from transition metals belonging to group 3 to group 11 of the periodic table thereby removing the first layer selectively, wherein the etching liquid contains a hexafluorosilicic acid compound, and an oxidizing agent of which concentration is 0.05% by mass or more and less than 10% by mass.. . ... Fujifilm Corporation

08/13/15 / #20150224787

Printing method

A printing method includes a step of supplying a first aggregating agent that induces an aggregation reaction of the white particles contained in the white particle ink, to the colored printing medium; a step of supplying, by the inkjet method, the white particle ink onto the colored printing medium having been supplied with the first aggregating agent such that aggregation of the white particles brings about increase in optical reflectance in a printing area; a step of supplying a second aggregating agent that is charged with same charge as that for the first aggregating agent and that induces an aggregation reaction of dye contained in dye ink, to the white particles aggregated; and a step of supplying, by the inkjet method, the dye ink to the white particles aggregated.. . ... Fujifilm Corporation

08/06/15 / #20150222804

Interchangeable lens camera, camera body, lens unit, and busy signal control method

. . An aspect of the present invention provides an interchangeable lens camera having a camera body and a lens unit that is freely attachable and detachable to the camera body. In the interchangeable lens camera, a communications unit in the camera body sends via communications terminals (mt_mosi and mt_miso) an intr_busy control instruction that instructs whether to make notification with a busy signal (intr_busy signal) for any operation out of a plurality of types of operations that can be executed, and the lens unit or camera body communications unit sets the busy signal (intr_busy) to an on state (low level) only during the period of operation of the type indicated by the intr_busy control instruction.. ... Fujifilm Corporation

08/06/15 / #20150222134

Electronic cassette charger

A charger includes a loading chamber into which a battery pack is insertably/removably loaded. An insertion opening into which the battery pack is inserted is formed on an upper surface of the main body. ... Fujifilm Corporation

08/06/15 / #20150221987

Electrolytic solution for non-aqueous secondary battery, and non-aqueous electrolytic solution secondary battery

An electrolytic solution for a non-aqueous secondary battery includes an electrolyte, a phosphazene compound and an aprotic solvent, in which 20 vol % to 90 vol % of the aprotic solvent is composed of a halogen-containing compound having a carbonyl group and a halogen atom.. . ... Fujifilm Corporation

08/06/15 / #20150221881

Resin composition for forming protective film, protective film, pattern forming method, method for manufacturing electronic device, and electronic device

There is provided a resin composition for use in formation of a protective film to protect a substrate or a film formed on the substrate, from a developer containing an organic solvent to be used for development in pattern formation, and which contains two or more kinds of resins in which their main chain structures having a hydroxyl group are different, and contains water, a pattern forming method using the resin composition, and layered products comprising a substrate, an organic semiconductor film on the substrate, and a protective film comprising two or more kinds of resins in which their main chain structures having a hydroxyl group are different, on the organic semiconductor film.. . ... Fujifilm Corporation

08/06/15 / #20150221876

Organic thin film transistor, organic semiconductor thin film, and organic semiconductor material

An organic thin film transistor containing a compound represented by the formula (1) in a semiconductor active layer has a high carrier mobility and a small fluctuation of the threshold voltage after repeated driving. R1 to r10 represent a hydrogen atom or a substituent, provided that at least one of r1 to r10 represents a substituent represented by the formula (w), or the aromatic hydrocarbon ring formed with any adjacent two of r1 to r10 has a substituent represented by the formula (w). ... Fujifilm Corporation

08/06/15 / #20150221343

Content management system, management content generation method, management content reproduction method, program and recording medium

In a content management system, a still image generation unit generates at least one piece of still image data based on moving image data. A still image selection unit causes a user to select one piece of still image data from among the generated at least one piece of still image data. ... Fujifilm Corporation

08/06/15 / #20150219993

Photosensitive transfer material, pattern formation method, and etching method

A photosensitive transfer material including a support, a thermoplastic resin layer, and a photosensitive resin composition layer in this order, in which the photosensitive resin composition layer includes a polymer component (a) including a polymer having a constituent unit (a1) that includes a group in which an acid group is protected by an acid-decomposable group and a photoacid generator (b).. . ... Fujifilm Corporation

08/06/15 / #20150219799

Optical member with antireflection film, and method of manufacturing the same

An antireflection film including a transparent thin film layer, and a transparent fine uneven layer whose main component is an alumina hydrate, which layers are formed in this order on a surface of a transparent substrate, is provided. The transparent thin film layer includes, in order from the transparent substrate side: an alumina layer; a water barrier layer which has a refractive index lower than the refractive index of the alumina layer and protects the alumina layer from water; and a flat layer whose main component is an alumina hydrate and whose refractive index is lower than the refractive index of the water barrier layer, and the water barrier layer has a thickness of 70 nm or less.. ... Fujifilm Corporation

08/06/15 / #20150219798

Optical member with antireflection film, and method of manufacturing the same

An antireflection film including a transparent thin film layer, and a transparent fine uneven layer whose main component is an alumina hydrate, which layers are formed in this order on a surface of a transparent substrate, is provided. The transparent thin film layer has an intermediate refractive index between the refractive index of the transparent substrate and the refractive index of the fine uneven layer, and the transparent thin film layer includes at least a nitride layer or an oxynitride layer.. ... Fujifilm Corporation

08/06/15 / #20150218184

Organic thin film transistor, organic semiconductor thin film, and organic semiconductor material

An organic thin film transistor containing a compound represented by the formula (1) in a semiconductor active layer has a high carrier mobility and a small fluctuation of the threshold voltage after repeated driving. R1 to r12 represent a hydrogen atom or a substituent, provided that at least one of r1 to r12 represents a substituent represented by the formula (w), or all of r1 to r12 represent a hydrogen atom. ... Fujifilm Corporation

08/06/15 / #20150216460

Endoscope system, processor device for endoscope system, operation method for endoscope system, and operation method for processor device

An endoscope system includes: a phosphor and first and second blue laser light sources that emit first white light and second white light having different emission spectrums; a sensor that images an observation target under illumination with the first white light and outputs a first image signal and images the observation target under illumination with the second white light and outputs a second image signal; a movement amount calculation unit that calculates the movement amount of the observation target based on the first or second image signal; and an oxygen saturation calculation unit that calculates the oxygen saturation based on the movement amount in at least one of a first mode, in which the oxygen saturation is calculated using the first and second image signals, and a second mode, in which the oxygen saturation is calculated using the first image signal.. . ... Fujifilm Corporation

08/06/15 / #20150216400

Endoscopic device

An endoscopic device that irradiates a plurality of illuminating lights having different spectrums from each other onto a subject at a front edge of an endoscope inserting module and captures the subject to obtain an observation image, includes an illuminating module that generates the plurality of illuminating lights, an imaging module that captures the subject and outputs an image signal of the observation image, a light intensity ratio control module that controls the illuminating module to irradiate the plurality of illuminating lights onto the subject with a set light intensity ratio by setting the light intensity ratio of the plurality of illuminating lights for every observation image, and a color tone correcting module that corrects the color tone of the image signal so as to obtain the observation image with substantially a same color tone even though the light intensity ratio is changed.. . ... Fujifilm Corporation

08/06/15 / #20150216394

Suction conduit switching apparatus and endoscope

A piston is inserted into a piston passage of a cylinder. The piston is displaced between a first position of a non-contact state and a second position by a pressing operation. ... Fujifilm Corporation

08/06/15 / #20150216393

Switching valve unit and endoscope apparatus

A suction button unit for changeover between a suction source and a suction opening includes a piston chamber extending axially. A suction port hole is formed at a lower end of the piston chamber, for connection with the suction opening. ... Fujifilm Corporation

07/30/15 / #20150215545

Imaging device and image display method

. . An imaging device includes a creation device configured to create a first display image, a second display image, and a third display image to be used for assisting the focusing confirmation from first and second images based on first and second image signals outputted from the first and second pixel groups, a display device, and a display control device, where the creation device creates the second display image including first and second display ranges in which the first image is used in the first display range and the second image is used in the second display range, and the creation device creates the third display image in which an image used in at least one of the first and second display ranges is different from the second display image.. . ... Fujifilm Corporation

07/30/15 / #20150214529

Non-aqueous electrolytic solution secondary battery

A non-aqueous electrolytic solution secondary battery includes: a positive electrode; a negative electrode; a separator that separates the positive electrode and the negative electrode from each other; and an electrolytic solution that is introduced into the non-aqueous electrolytic solution secondary battery so as to come into contact with the positive electrode and the negative electrode with the separator interposed therebetween, wherein the electrolytic solution contains an electrolyte and a phosphazene compound in an aprotic solvent, and the separator is a complex that is composed of a substrate containing a non-heat-resistant resin and a heat-resistant material coating the substrate.. . ... Fujifilm Corporation

07/30/15 / #20150213837

Image processing device, print production system, photograph album production system, image processing method, and program

The image processing device includes an image data input unit for receiving data of moving images and still images; an image grouping unit for classifying the moving images and the still images into groups; an image analyzer for analyzing the moving images and the still images classified by group, and obtaining analysis information of the images, and information on relationship between the moving images and the still images; a frame image extractor for extracting frame images from the moving images according to at least one of the analysis information and the relationship information; a layout determining unit for determining a layout of the still images and the frame images according to at least one of the analysis information and the relationship information; and an image arranging unit for arranging the still images and the frame images according to the layout.. . ... Fujifilm Corporation

07/30/15 / #20150212777

Data processing apparatus, data processing method, and nontransitory storage medium

A data processing apparatus extracts operators (including particular operators) describing character strings in a text format, at least one by one, from among acquired page data. The data processing apparatus determines an order in which two or more of the page data containing the particular operators whose font information coincides with each other are to be arranged according to a sequence indicated by particular characters.. ... Fujifilm Corporation

07/30/15 / #20150212406

Positive photosensitive resin composition and cured film forming method using the same

There are provided a positive photosensitive resin composition excellent in the sensitivity, film residual ratio and storage stability, comprising a resin containing a specific acrylic acid-based constituent unit capable of dissociating an acid-dissociable group to produce a carboxyl group, the resin being alkali-insoluble or sparingly alkali-soluble and becoming alkali-soluble when the acid-dissociable group dissociates, a resin containing a constituent unit having a functional group capable of reacting with the carboxyl group to form a covalent bond, and a compound capable of generating an acid upon irradiation with an actinic ray or radiation; a cured film forming method using the positive photosensitive resin composition; and a cured film excellent in the heat resistance, adhesion, transmittance and the like.. . ... Fujifilm Corporation

07/30/15 / #20150212368

Liquid crystal display

There is provided a liquid crystal display including: a liquid crystal cell in which a liquid crystal layer is installed between two glass substrates; polarizing plates on both surfaces of the liquid crystal cell; and a backlight at a rear side of the liquid crystal cell, which is a non-visual side, wherein in a polarizing plate at a front side of the liquid crystal cell, which is a visual side, a difference in a moisture content of the polarizing plate at the front side under a specific condition in elapse of time is 0.01% or more and 3.0% or less.. . ... Fujifilm Corporation

07/30/15 / #20150212302

Imaging lens and imaging apparatus

An imaging lens consists essentially of, in order from the object side, a first lens group having a positive refractive power, a stop, and a second lens group having a positive refractive power. The first lens group includes, in order from the object side, two successive positive lenses, and a negative lens having a concave surface toward the image side. ... Fujifilm Corporation

07/30/15 / #20150212299

Imaging lens

An imaging lens substantially consists of five lenses of a first lens having a meniscus shape with its convex surface facing an object side and negative refractive power, a second lens having negative refractive power, and the image-side surface of which has a convex shape facing an image side in the vicinity of an optical axis, a third lens having positive refractive power, a stop, a fourth lens having positive refractive power, and a fifth lens having negative refractive power. At least one of the surfaces of the first lens through the fifth lens is aspherical. ... Fujifilm Corporation

07/30/15 / #20150212298

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is essentially constituted by seven lenses, including: a positive first lens having a convex surface toward the object side; a second lens, of which at least one surface is of an aspherical shape; a third lens, of which at least one surface is of an aspherical shape; a fourth lens, of which at least one surface is of an aspherical shape; a positive fifth lens of a meniscus shape with a convex surface toward the image side; a sixth lens, of which at least one surface is of an aspherical shape; and a negative seventh lens having a concave surface toward the image side, provided in this order from the object side. The imaging lens satisfies a predetermined conditional formula.. ... Fujifilm Corporation

07/30/15 / #20150212246

Circularly polarizing plate, method for manufacturing same, and optical laminate

There are provided a circularly polarizing plate which includes an optically anisotropic layer formed by using a discotic liquid crystal compound and an optically anisotropic layer formed by using a rod-like liquid crystal compound, inhibits an alignment defect of the rod-like liquid crystal compound, and has excellent visibility. The circularly polarizing plate has an optical laminate and a polarizing film.. ... Fujifilm Corporation

07/30/15 / #20150210879

Laminated film and method for producing the same

A laminated film containing a polyester film and a coating layer wherein the coating layer contains an acid-modified polyolefin resin and a basic compound having a boiling point of 200° c. Or less, and, the polyester film contains a compound that is derived from the acid-modified polyolefin resin contained in the coating layer, can be produced by an in-line coating method. ... Fujifilm Corporation

07/30/15 / #20150210072

Head-driving method, head-driving device, and inkjet printing device

A head-driving method includes outputting, to a plurality of head modules arranged in a recording head, nozzle control data via a data bus, wherein the data bus is shared between the plurality of head modules with the data being switched sequentially every bit, setting the nozzle control data for each head module to be supplied via the data bus as nozzle data for each of the head modules at a timing depending on each of the head modules, and outputting a drive voltage signal to an ejection energy generating element configured to eject liquid in each of the head modules.. . ... Fujifilm Corporation

07/30/15 / #20150209733

Process for preparing membranes

A process for preparing a composite membrane comprising the steps: a)applying a radiation-curable composition to a porous support; b)irradiating the composition and thereby forming a gutter layer of cured polymer; and c)forming a discriminating layer on the gutter layer; wherein the radiation-curable composition comprises a partially crosslinked, radiation-curable polymer comprising epoxy groups and siloxane groups, a photoinitiator and is substantially free from mono-epoxy compounds. Composite membranes and gas separation cartridges are also claimed.. ... Fujifilm Corporation

07/30/15 / #20150208958

Processor device, endoscope system, operation method for endoscope system

An endoscope image input unit 60 receives a current endoscope image signal that is output from an endoscope, which is currently inserted into a subject, and is used to calculate the oxygen saturation. A spectral estimation section 70 generates a spectral estimation image by performing spectral estimation processing on a past endoscope image signal that is obtained during the past endoscope insertion and is different from a signal for oxygen saturation calculation. ... Fujifilm Corporation

07/23/15 / #20150208051

Image-processing device, image-capturing device, image-processing method, and recording medium

. . . . A restoration process using a restoration filter that is based on a point spread function for an optical system is performed for original image data acquired from an image-capturing element by an image taking of an object image using the optical system, so that recovery image data are acquired. The above restoration process is performed, in a point-image restoration processing section, for color data of the original image data in which a gradation correction has been performed by a logarithmic process. ... Fujifilm Corporation

07/23/15 / #20150207962

Image-processing device, image-capturing device, image-processing method, and recording medium

According to an aspect of the present invention, for which of the original image data before the gradation correction and the original image data after the gradation correction the restoration process is performed is determined depending on whether or not the image information meets the condition under which the ringing appears in the recovery image data due to the restoration process. When the gradation correction is performed after the restoration process, there is a probability that the side effect (the ringing or the like) of the restoration process is emphasized by the gradation correction. ... Fujifilm Corporation

07/23/15 / #20150205205

Positive type resist composition for use in liquid immersion exposure and a method of forming the pattern using the same

A positive type resist composition for use in liquid immersion exposure comprises: (a) a resin having a monocyclic or polycyclic cycloaliphatic hydrocarbon structure, the resin increasing its solubility in an alkali developer by an action of acid; (b) a compound generating acid upon irradiation with one of an actinic ray and a radiation; (c) an alkali soluble compound having an alkyl group of 5 or more carbon atoms; and (d) a solvent.. . ... Fujifilm Corporation

07/23/15 / #20150205085

Film mirror, and composite film for use in same

The film mirror includes a resin substrate; a metal reflective layer; and a surface coating layer, a ratio of a number of fluorine atoms to a number of carbon atoms in a surface layer portion of the surface coating layer as expressed by f/c is 0.21 to 1.00 and the surface coating layer has a surface hardness of more than 100 n/mm2 and an elastic recovery rate of 60% or more. The film mirror has stain-proof properties, and scratch resistance so that the surface is resistant to scratches in collision with sandy dust and is also resistant to scratches upon cleaning with a brush.. ... Fujifilm Corporation

07/23/15 / #20150205077

Imaging lens and imaging aparatus

An imaging lens consisting of a front group, a stop, and a rear group. The first and the second lenses from the object side in the front group are a negative meniscus lens with a convex surface on the object side and a negative lens respectively. ... Fujifilm Corporation

07/23/15 / #20150205024

Optical laminate

The optical laminate includes a surface protection film; a transparent support; an optically anisotropic layer; an adhesive layer; and a release film in this order, and the optically anisotropic layer is a patterned optically anisotropic layer which includes a first phase difference region and a second phase difference region differing from each other in terms of the direction of an in-plane slow axis and in which the first and second phase difference regions are alternately disposed within a plane of the optically anisotropic layer, the transparent support contains a polymer material and has a thickness of 10 μm to 59 μm, and a Δ moisture content falls within a predetermined range. The optical laminate can be stuck on a display apparatus with high accuracy and can improve a vertical viewing angle of the display apparatus after being stuck on the display apparatus.. ... Fujifilm Corporation

07/23/15 / #20150204987

Radiographic image detection device

In a photoelectric conversion panel, a plurality of tfts are formed over an insulating substrate. The tfts are covered by a first planarizing film. ... Fujifilm Corporation

07/23/15 / #20150204986

Radiographic image detection device

A monocoque-structured housing accommodates a photoelectric conversion panel, a scintillator, and a circuit board in this order from an x-ray incidence side. The scintillator contains cesium iodide and converts x-rays into visible light. ... Fujifilm Corporation

07/23/15 / #20150203718

Laminated film, optical laminated film, and display device

A laminated film having a support and a backcoat film containing a silicon-containing resin, a matting agent and a surfactant wherein the silicon-containing resin contains a condensate of a tetrafunctional alkoxysilane and a trifunctional or bifunctional alkoxysilane in a molar ratio of 25/75 to 85/15, a volume average particle diameter of the matting agent is bigger than an average thickness of the backcoat film, and a content of inorganic fine particles in the backcoat film is 20% or less, can suppress generation of iridescent unevenness, luminance decrease and surface irregularity.. . ... Fujifilm Corporation

07/23/15 / #20150202867

Droplet-discharging head, image-forming device, and method for positioning head modules of droplet-discharging head

Provided are a droplet-discharging head, a droplet-discharging device, and a method for positioning head modules of the droplet-discharging head in which the job of adjusting head module installation positions can be easily performed. In an ink jet head (200) configured by linking multiple head modules (210) together, each head modules (210) is mounted on a base frame (212) supported by a head module support unit provided on the base frame (212). ... Fujifilm Corporation

07/23/15 / #20150202344

Cell construct for cell transplantation and cell aggregate for cell transplantation

An object of the present invention is to provide a cell construct for cell transplantation capable of having a thickness suitable for cell transplantation, preventing the necrosis of transplanted cells, and forming blood vessels in the transplantation site after transplantation. The present invention provides a cell construct for cell transplantation which comprises polymer blocks having biocompatibility and cells of at least one type, wherein the plural polymer blocks are arranged in spaces between the plural cells.. ... Fujifilm Corporation

07/23/15 / #20150202228

Sleep-improving agent, non-rem sleep time-increasing agent, and sedative agent

A sleep-improving agent, a non-rem sleep time-increasing agent, and a sedative agent, each of which includes a lipid-soluble antioxidant and a divalent metal as active ingredients.. . ... Fujifilm Corporation

07/23/15 / #20150201909

Ultrasound inspection apparatus, signal processing method for ultrasound inspection apparatus, and recording medium

An ultrasound inspection apparatus includes a region setting section setting a plurality of regions within the inspection object; a sound velocity calculator calculating a sound velocity of each of the plurality of regions; a sound velocity obtainer obtaining a preliminary sound velocity of a region of interest; and an image quality determiner determining an image quality of the region of interest based on the preliminary sound velocity. The preliminary sound velocity obtained by the sound velocity obtainer is employed as a sound velocity of the region of interest when a determination result made by the image quality determiner is positive, and the sound velocity of the region of interest is calculated by the sound velocity calculator when the determination result is negative.. ... Fujifilm Corporation

07/23/15 / #20150201871

Endoscope system processor device, endoscope system, operation method for endoscope system processor device, and operation method for endoscope system

There are provided an endoscope system processor device, an endoscope system, an operation method for an endoscope system processor device, and an operation method for an endoscope system for calculating objective diagnostic information, which is easier to understand than the oxygen saturation, based on the oxygen saturation. The endoscope system processor device includes: a receiving unit that receives an image signal obtained by imaging an observation target with an endoscope; an oxygen saturation calculation unit that calculates an oxygen saturation based on the image signal; a pixel specification unit that specifies an out-of-range pixel in which the oxygen saturation deviates from a specific range set in advance; and a diagnostic information calculation unit that calculates diagnostic information as a numerical value using information of the out-of-range pixel.. ... Fujifilm Corporation

07/16/15 / #20150201491

Pattern forming method, electronic wiring substrate, optical device, and pattern forming apparatus

. . A pattern forming method of ejecting inks in the form of droplets to a base material including a first region and a second region which differ from each other in terms of surface energy by an ink jet method, includes: a preparation step of preparing the base material including the first region and the second region; and a droplet ejection step of simultaneously ejecting a first ink and a second ink in the form of droplets to the first region and the second region respectively by using a multipass method, wherein the inks are at least two kinds of inks including the first ink having volatility and the second ink having curability, the first ink and the first region are lyophilic, and the second ink and the second region are lyophilic.. . ... Fujifilm Corporation

07/16/15 / #20150201143

Image-processing device and method, and image pickup device

An image-processing device includes an image acquiring device, an encoded aperture pattern setting device configured to set encoded aperture patterns for multiple pupil images of the main lens, respectively, a calculation device configured to perform a weighted product-sum calculation between the pupil image for each lens of the lens array in the image acquired from the image sensor and the encoded aperture pattern set by the encoded aperture pattern setting device, and an image generating device configured to generate an image based on a calculation result by the calculation device.. . ... Fujifilm Corporation

07/16/15 / #20150201123

Imaging device and method for controlling same

An imaging device includes an imaging lens, a generation device, a display device, a generation control device, and a display control device configured to control the display device to display the first display image generated by the generation device and display the second display image generated by the generation device in a display region of the first display image, and to display the second display image in a position corresponding to the main object image in the first display image when the main object image is detected by the detection device, wherein the detection device can detect an eye position in the main object image, and when the eye position is detected by the detection device, the generation control device controls the generation device to generate a division image that divides the main object image with the eye position as a boundary from the first and second images.. . ... Fujifilm Corporation

07/16/15 / #20150200315

Electronic module

An electronic module is provided which includes an electronic device in which an electronic element is provided on a flexible substrate that does not transmit water vapor, an edge sealant provided at a peripheral edge of the flexible substrate of the electronic device, and a water vapor barrier film provided so as to cover a region surrounded by the edge sealant. When a square root of twice a diffusion coefficient of the edge sealant is denoted by k, k is not greater than 0.1 cm/√h. ... Fujifilm Corporation

07/16/15 / #20150199832

Image processing apparatus, image processing program, and operation method of image processing apparatus

When using a graph cut process for binary labeling, labeling unit selects n (>3) pixels in image data in such a manner to represent a predetermined shape in the image, minimize the high-order energy of the nth order or greater in which the pixel values of the n pixels are variables, and performs labeling.. . ... Fujifilm Corporation

07/16/15 / #20150199795

Image processing device, imaging device, computer, image processing method and computer readable non-transitory medium

An image processing device includes a statistical information acquiring unit, an optical information acquiring unit, a filter information calculating unit and a filter coefficient calculating unit. The filter information calculating unit obtains filter information of a restoration filter for point image restoration processing according to at least one of statistical information and optical information. ... Fujifilm Corporation

07/16/15 / #20150199587

Image processing device, image processing method, and image processing program

Based on a long diameter of a set specific region, a first region estimated as the specific region and a second region estimated as a background region are set within an input image. Based on a density histogram of each pixel in the first region and a density histogram of each pixel in the second region, a first evaluation value which indicates a likelihood that a density value represents the specific region is calculated for each density value. ... Fujifilm Corporation

07/16/15 / #20150199586

Image processing device, method, and program

A region setting unit and a specific region extracting unit are included. The region setting unit sets, within an input image that is photographed at a reference time point out a first region estimated as highly probable to be a specific region and a second region estimated as highly probable to be a background region, which is a region other than the specific region. ... Fujifilm Corporation

07/16/15 / #20150198972

Electroconductive film, and touch panel and display device provided with same

An electroconductive film is provided on a display unit and has at least two wiring layers that are disposed on both sides of a transparent substrate or each disposed on either side of each of the at least two transparent substrates in a laminate form and are regularly arranged. A wiring pattern of the wiring layers is superimposed onto a pixel array pattern of the display unit, the wiring pattern of a lower layer being displaced in phase in relation to an upper layer. ... Fujifilm Corporation

07/16/15 / #20150198885

Lithographic printing plate precursor and plate making method

A lithographic printing plate precursor includes a support and an image-recording layer containing (a) an infrared absorbing agent, (b) a sulfonium salt, (c) a polymerizable compound, and (d) a binder polymer, the sulfonium salt (b) has a triarylsulfonium structure having three or more electron-withdrawing groups as substituents, and at least one aryl group constituting the triarylsulfonium structure has at least one of the electron-withdrawing groups and at least one group selected from the group consisting of a hydrocarbon group having from 4 to 12 carbon atoms, a group wherein a hydrocarbon group having from 4 to 12 carbon atoms is connected to an oxygen atom or a sulfur atom, and an ethylene oxide group having a repeating unit number of from 1 to 3.. . ... Fujifilm Corporation

07/16/15 / #20150198878

Lithographic printing plate precursor and plate making method of lithographic printing plate

By a lithographic printing plate precursor including a support having provided thereon an image-recording layer capable of forming an image by supplying at least any of printing ink and dampening water on a printing machine after image exposure to remove an unexposed area thereof, wherein the image-recording layer contains an infrared absorbing agent, a polymerization initiator, a polymerizable compound and a polysaccharide having a sulfonic acid group or a group made by a salt thereof and a plate making method of a lithographic printing plate using the same, a lithographic printing plate precursor which exhibits good development property while maintaining printing durability of a lithographic printing plate after development and a plate making method of a lithographic printing plate using the same can be provided.. . ... Fujifilm Corporation

07/16/15 / #20150198815

Image processing apparatus and method, and printer and display apparatus

An image processing apparatus and method in which not only a partial image in a stereo image but also an image in a large range of near and far sides can be viewed are provided. First to twelfth viewpoint images are generated so that no disparity occurs in a portion specified as a principal object image. ... Fujifilm Corporation

07/16/15 / #20150198801

Mirror driving device and driving method for same

A mirror driving device is provided. A pair of piezoelectric actuator units are disposed at both sides of a mirror unit so as to sandwich the mirror unit, and each piezoelectric actuator unit is connected with an end portion of the mirror unit through a linking unit. ... Fujifilm Corporation

07/16/15 / #20150198790

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens, substantially consisting of five lenses, composed of a positive first lens with a convex surface on the object side, a negative second lens with a concave surface on the object side, a third lens having a negative meniscus shape with a convex surface on the object side, a fourth lens having a positive meniscus shape with a concave surface on the object side, and a negative fifth lens with a concave surface on the image side, the image side surface having an aspherical shape with at least one inflection point located inward in a radial direction from the intersection between the image side surface and a principal ray of the maximum angle of view toward the optical axis, disposed in order from the object side, and satisfies given conditional expressions.. . ... Fujifilm Corporation

07/16/15 / #20150198789

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is substantially constituted by five lenses, including: a positive first lens having a convex surface toward the object side; a negative second lens having a concave surface toward the object side; a positive third lens of a meniscus shape with a convex surface toward the object side; a positive fourth lens of a meniscus shape with a concave surface toward the object side; and a negative fifth lens having a concave surface toward the image side, the surface thereof toward the image side being of an aspherical shape having at least one inflection point within a range from an intersection of a principal light ray at a maximum angle of view with the surface toward the image side inwardly toward the optical axis in the radial direction, provided in this order from the object side. The imaging lens satisfies predetermined conditional formulae.. ... Fujifilm Corporation

07/16/15 / #20150198788

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is substantially constituted by five lenses, including: a positive first lens having a convex surface toward the object side; a negative second lens of a meniscus shape with a concave surface toward the object side; a positive third lens of a meniscus shape with a convex surface toward the object side; a positive fourth lens of a meniscus shape with a concave surface toward the object side; and a negative fifth lens having a concave surface toward the image side, the surface thereof toward the image side being of an aspherical shape having at least one inflection point within a range from an intersection of a principal light ray at a maximum angle of view with the surface toward the image side inwardly toward the optical axis in the radial direction, provided in this order from the object side. The imaging lens satisfies a predetermined conditional formula.. ... Fujifilm Corporation

07/16/15 / #20150198783

Lens driving apparatus and method

A lens driving apparatus for a lens includes a voice coil motor. A coil position of a coil is detected. ... Fujifilm Corporation

07/16/15 / #20150198753

Film mirror

There is provided a film mirror having excellent weather resistance and flexibility. The film mirror includes a resin substrate, and a metal reflective layer, a diffusion preventive layer, and a surface protection layer laminated on the resin substrate in this sequence, in which the diffusion preventive layer has a layer obtained by performing either or both of heating process and light irradiation process on a precursor layer that is formed by using either or both of a metal alkoxide, which has an acryloyloxy group or a methacryloyloxy group, and a hydrolysis condensate of the metal alkoxide.. ... Fujifilm Corporation

07/16/15 / #20150198742

Optical film, polarizing plate and liquid crystal display device

There is provided an optical film which is a cellulose acylate film including a cellulose acylate and a sugar ester compound having at least one aromatic group, the film having a film thickness of 15 μm to 35 μm, in which a number density of the aromatic group of the sugar ester compound is 0.90×10−3 mol or more and 5.00×10−3 mol or less per 1 g of a solid component in the cellulose acylate film.. . ... Fujifilm Corporation

07/16/15 / #20150198566

Ultrasound diagnostic apparatus, ultrasound image generation method, and recording medium

The ultrasound diagnostic apparatus acquires an ultrasound image for examining an inspection object using an ultrasonic beam, and includes a sound velocity determiner configured to determine a sound velocity in the inspection object, and a sound velocity searching range setting section configured to set a range in which a sound velocity is searched by the sound velocity determiner. The sound velocity searching range setting section sets a sound velocity searching range using a sound velocity calculated in a predetermined range with respect to at least one of space and time.. ... Fujifilm Corporation

07/16/15 / #20150198536

Optical electric field enhancing device, method of manufacturing the same, and measuring apparatus employing the same

An optical electric field enhancing device is used with a measuring method which includes two-dimensionally scanning a surface in in-plane direction of the surface to detect, from the rear surface side of the device, signal light emitted from each scanning point when excitation light is applied, and obtaining a two-dimensional signal image on the surface based on the detected signal light. The device includes a transparent substrate, a marker pattern directly formed on the transparent substrate and extending in a direction non-parallel to the main scanning direction of the two-dimensional scanning, and fine uneven structures formed on the marker pattern and the transparent substrate where at least the surface is made of a metal film.. ... Fujifilm Corporation

07/16/15 / #20150198535

Light measuring apparatus employing optical electric field enhancing device

Using an optical electric field enhancing device including a fine uneven structure made of gold formed on the front surface of a transparent substrate, illumination light of a wavelength in the range from 400 to 530 nm is applied at least to an analyte, positional information of the analyte is detected by a position detection unit disposed on the rear surface side of the optical electric field enhancing device, and excitation light is applied to the detected position by an excitation light application unit. Signal light emitted from the analyte when the excitation light is applied is detected from the rear surface side of the transparent substrate.. ... Fujifilm Corporation

07/16/15 / #20150197663

Self-organizing composition for forming pattern, method for forming pattern by self-organization of block copolymer using same, and pattern

There is provided a pattern forming method through self-organization of a block copolymer, containing an annealing step after application of a self-organizing composition for forming pattern that contains a block copolymer containing a block having a repeating unit represented by the specific general formula, and contains an organic solvent, to a substrate, and wherein after a microphase-separated structure is formed in the annealing step, one domain thereof is selectively removed to form a pattern.. . ... Fujifilm Corporation

07/16/15 / #20150197651

Ink composition, inkjet recording method, printed material, bisacylphosphine oxide compound, and monoacylphosphine oxide compound

The object of the present invention is to provide an ink composition that is excellent in terms of adhesion to a recording medium, for which there is little leaching out (migration) of a component in the cured ink film, and that gives a printed material with suppressed odor, and an inkjet recording method and a printed material employing the ink composition, and also to provide a novel acylphosphine oxide compound. The ink composition of the present invention contains an acylphosphine oxide compound having an acyl group comprising a polymerizable functional group, and a polymerizable compound.. ... Fujifilm Corporation

07/16/15 / #20150197592

Semi-cured product, cured product and method for producing these, optical component, curable resin composition, and compound

A curable resin composition containing a compound of formula (1), a compound of formula (2) and a thermal- or photo-radical polymerization initiator is capable of producing a cured product having a low abbe's number and capable of realizing burr reduction in molding the composition. Ar1 to ar4 represent aryl or heteroaryl, at least one of ar1 to ar4 is aromatic condensed ring, and two or more of ar1 to ar4 have a polymerizable group, and at least one of r21 to r26 forms a ring, or at least two bond to each other to form a ring:. ... Fujifilm Corporation

07/16/15 / #20150197079

Process for producing cylindrical printing plate precursor, cylindrical printing plate and process for making same

There is provided a process for producing a cylindrical printing plate precursor, comprising (1) a preparation step of preparing a cured resin sheet, (2) a wrapping step of wrapping the cured resin sheet around a cylindrical support, (3) a supply step of supplying a curable composition to a gap formed between end parts to be joined of the cured resin sheet, and (4) a curing step of curing the curable composition, the curable composition comprising a solvent that dissolves or swells the cured resin sheet, the solvent having a content of 0.2 to 2.0 mass % of the total amount of the curable composition, and the curable composition having a percentage dimensional change on curing of no greater than 2%.. . ... Fujifilm Corporation

07/16/15 / #20150196746

Needle array transdermal absorption sheet and method for manufacturing needle array transdermal absorption sheet

A needle array transdermal absorption sheet to be attached onto a skin for supplying a drug into the skin, includes: a plurality of needle portions each having a tapered shape, each of the needle portions including a needle having a conical or pyramidal shape and a body part which has a columnar shape and whose end surface is connected to a base of the needle; a sheet portion having a flat-plate shape; and a plurality of frustum portions each having a frustum shape, the frustum portions which are arranged on a surface of the sheet portion in a manner that perimeters of larger bases of adjacent frustum portions are in contact with each other on the surface of the sheet portion, and smaller bases of which are respectively connected to the body parts of the needle portions.. . ... Fujifilm Corporation

07/16/15 / #20150196284

Ultrasound diagnostic apparatus, sound velocity determining method, and recording medium

In the ultrasound diagnosis, a probe performs transmission of an ultrasonic beam a plurality of times so as to form predetermined transmission focus points, the analog reception data output by the probe is a/d converted to turn into a first element data, a plurality of first element data is used to generate a second element data corresponding to any one of the plurality of first element data, and a sound velocity is determined using the first element data in a case where the position for determining the sound velocity is in a vicinity of the transmission focus point and using the second element data in a case where the position is not in a vicinity of the transmission focus point. In this manner, the sound velocity of the ultrasound waves in an inspection object can be accurately determined without decreasing the frame rate.. ... Fujifilm Corporation

07/16/15 / #20150196283

Ultrasound diagnostic apparatus, sound velocity determining method, and recording medium

In the ultrasound diagnostic apparatus, the method of determining the sound velocity, and the program recorded in a recording medium, a probe is made transmit an ultrasonic beam a plurality of times so as to form a predetermined transmission focus point, an analog element signal output by the probe is a/d converted into the first element data, the second element data corresponding to any one of a plurality of the first element data is generated, and the second element data is used to determine the sound velocity in an inspection object, whereby the sound velocity of the ultrasonic waves in the inspection object can be accurately determined without decreasing the frame rate.. . ... Fujifilm Corporation

07/16/15 / #20150196280

Ultrasound diagnostic apparatus, ultrasound image generating method, and recording medium

There are provided an ultrasonic diagnostic apparatus, an ultrasound image generating method, and a recording medium having stored therein a program capable of generating an ultrasound image with a precision close to that of multi-focus even with a moving image. In the case of a motion picture photographing mode, transmission/reception is performed with single focus, and multi-line processing is performed based on received element data. ... Fujifilm Corporation

07/16/15 / #20150196278

Ultrasound diagnostic apparatus and ultrasound image producing method

Disclosed are an ultrasound diagnostic apparatus and an ultrasound image producing method capable of producing a spatial compound image with reduced artifacts. Reception data of frame images is repeatedly acquired in a data acquisition cycle of four frames such that, of three frame images for use in producing a spatial compound image, the angle difference in steering angle between two frames for which the acquisition of reception data is most temporally separated is smaller than a maximum value among the angle differences in steering angle between two frame images among three frame images having different steering angles, and each time reception data of two frame images or reception data of another two frame images is acquired, three frame images sequentially produced based on reception data for three frames sequentially acquired hitherto are synthesized to produce a spatial compound image.. ... Fujifilm Corporation

07/16/15 / #20150196274

Ultrasound inspection apparatus, ultrasound inspection method and recording medium

An ultrasound inspection apparatus of the present invention includes: a probe provided with a plurality of elements; a transmitter configured to transmit the ultrasonic beam to an inspection object using the probe; a receiver configured to receive an ultrasonic echo signal from the inspection object; a sound velocity determiner configured to determine a sound velocity value inside the inspection object; and an element data processing section configured to generate a piece of second element data from at least two pieces of first element data using the sound velocity value, the piece of second element data corresponding to any of the at least two pieces of first element data, the sound velocity determiner being configured to obtain an optimum sound velocity value by optimizing the sound velocity value which is used when the piece of second element data is created in the element data processing section.. . ... Fujifilm Corporation

07/16/15 / #20150196273

Ultrasound inspection device, ultrasound image data generation method, and recording medium

The present invention provides an ultrasound inspection device, an ultrasound image data generation method, and a computer-readable recording medium in which is stored a program, which determine for each of data calculation points whether or not the distance to a transmission focal point is with a predetermined range, and when the distance from the data calculation point to the transmission focal point is outside the predetermined range, superimposition of a plurality of first element data is carried out assuming an ultrasonic beam to be a convergent wave, and when the distance from the data calculation point to the transmission focal point is within the predetermined range, the superimposition of the plurality of first element data is carried out assuming an ultrasonic beam to be a planar wave to thereby generate second element data corresponding to the data calculation points.. . ... Fujifilm Corporation

07/09/15 / #20150195908

Wiring board

. . . . A wiring board includes: an insulating substrate; and a wiring layer including a first metal layer disposed on the insulating substrate and a second metal layer disposed so as to cover a surface of the first metal layer, the surface not being in contact with the insulating substrate, wherein the thickness of the second metal layer is 1/10 of the total thickness of the wiring layer, the wiring layer contains a migration inhibitor, and the mass y of the migration inhibitor contained in the second metal layer is greater than the mass x of the migration inhibitor contained in the first metal layer.. . ... Fujifilm Corporation

07/09/15 / #20150195542

System and method of managing medical image

In a medical image managing system, there are first and second density conversion modes. In the first density conversion mode, a medical image is processed in density conversion by an image server, before a density-converted medical image is transmitted to a client terminal. ... Fujifilm Corporation

07/09/15 / #20150195473

Imaging device and signal processing method

An imaging device to which an imaging optical system is attachable, includes a correction data generating unit that generates correction data to correct a sensitivity difference of first phase difference detecting pixel cells and second phase difference detecting pixel cells; and a signal correcting unit that corrects at least one of an output signal of the first phase difference detecting pixel cells and an output signal of the second phase difference detecting pixel cells in accordance with the correction data, in which the correction data generating unit calculates two ratios to generate the correction data based on the two ratios.. . ... Fujifilm Corporation

07/09/15 / #20150195449

Device and method for measuring distances to multiple subjects

A device for measuring distances to multiple subjects includes an imaging optical system, a pupil orientation sensor having multiple pixels including photoelectric conversion elements arranged two-dimensionally, the pupil orientation sensor selectively receiving a light flux passed through any of the multiple regions, an image acquisition device configured to simultaneously acquire each of multiple images corresponding to the multiple regions from the pupil orientation sensor, a focusing control device configured to independently drive the physically-separated multiple lenses of the imaging optical system on the basis of the multiple images acquired by the image acquisition device to control the lenses to be focused on multiple subjects each having a different focusing distance, and a first calculation device configured to calculate each of the focusing distances to the multiple subjects respectively subjected to focusing control by the focusing control device.. . ... Fujifilm Corporation

07/09/15 / #20150195448

Imaging device and image processing method

According to the present invention, even if variation (estimation variation) is caused in a subject distance estimated at the time of imaging when restoration processing of a taken image is performed using a restoration filter corresponding to the subject distance, since an optimal restoration filter that conforms to a subject distance taking into account the maximum infinity-side estimation variation and does not cause overcorrection is selected, it is possible to prevent resolution degradation due to overcorrection and achieve the improvement of resolution by the restoration filter.. . ... Fujifilm Corporation

07/09/15 / #20150195447

Imaging device and image processing method

According to the present invention, when restoration processing of a taken image by the use of a restoration filter corresponding to a subject distance is performed, by storing only a corresponding restoration filter in a subject distance range between the estimation variation close range and the infinity such that a restoration filter in a range on the nearer side than the estimation variation close range is not provided from the beginning, it is thereby possible to reduce the number of restoration filters held beforehand.. . ... Fujifilm Corporation

07/09/15 / #20150194591

Piezoelectric device and method for using same

A piezoelectric device, which has bipolar polarization-electric field (pr-e) hysteresis characteristics of a piezoelectric material asymmetrically biased, when a first and second coercive electric fields respectively having smaller and larger absolute values are defined as ec1 and ec2 and a bias ratio of the coercive electric field is defined as [(ec2+ec1)/(ec2−ec1)]×100[%], includes a piezoelectric element unit including a piezoelectric body film whose bias ratio is 20% or more, the piezoelectric element unit operating with an electric field intensity smaller than that of the first coercive electric field. The piezoelectric device includes a refresh voltage applying circuit configured to apply a voltage to maintain operation performance of the relevant device, the voltage having an electric field intensity larger than the electric field intensity for operating the device and being equal to or less than three times. ... Fujifilm Corporation

07/09/15 / #20150194464

Solid-state imaging device and manufacturing method of solid-state imaging device

A light receiving layer is formed with an array of photodiodes for accumulating signal charge produced by photoelectric conversion of incident light. A wiring layer provided with electrodes and wiring for controlling the photodiodes is formed behind the light receiving layer in a traveling direction of the incident light. ... Fujifilm Corporation

07/09/15 / #20150194235

Method of manufacturing conductive film and composition for forming conductive film

A conductive film manufacturing method includes a coating formation step of forming a coating by applying onto a thermoplastic resin substrate a conductive film-forming composition including copper oxide particles (a), copper particles (b), and an organic polymer (c), a ratio of a copper particle (b) content to a copper oxide particle (a) content as expressed by b/a being 10 to 50 wt %, and a reduction step of reducing the copper oxide particles (a) through irradiation of the coating with pulsed light, thereby forming a copper-containing conductive film. The conductive film obtained by irradiation with pulsed light according to this method has good adhesion to the thermoplastic resin substrate.. ... Fujifilm Corporation

07/09/15 / #20150193966

Virtual endoscopic image generation device, method, and medium containing program

A structure extracting unit extracts a structure from a three-dimensional medical image, and a view point determining unit determines a view point position and a direction of line of sight of a virtual endoscopic image. An image generating unit calculates a distance between a view point position and the extracted structure, determines a display attribute of the extracted structure based on the distance and a plurality of different display attributes that correspond to different distances from the view point position and are defined for each of the structures, and generates, from the three-dimensional medical image, a virtual endoscopic image containing the structure having the determined display attribute. ... Fujifilm Corporation

07/09/15 / #20150193948

Body motion detection device and method

A contrast calculating unit calculates a contrast of a high frequency component and a contrast of a low frequency component of a transformed radiographic image at an analysis point set by an analysis point setting unit. A ratio calculating unit calculates a ratio of the contrast of the high frequency component to the contrast of the low frequency component. ... Fujifilm Corporation

07/09/15 / #20150193943

Image processing apparatus, method and program

An image obtainment unit obtains plural ct images from an x-ray ct apparatus, and generates a three-dimensional image. A low-resolution image generation unit performs multi-resolution transformation on the three-dimensional image, and generates a low resolution image. ... Fujifilm Corporation

07/09/15 / #20150192853

Conductive film manufacturing method, conductive film, and recording medium

Disclosed is a method for manufacturing a conductive film in which a mesh pattern comprising a wire material is provided on a base material. Also disclosed are a conductive film and a recording medium. ... Fujifilm Corporation

07/09/15 / #20150192852

Lithographic printing plate precursor and plate making method

By a lithographic printing plate precursor comprising a support having provided thereon an image-recording layer containing (a) a radical polymerization initiator, (b) a radical polymerizable compound, and (c) a polyfunctional polymerization inhibitor, wherein the polyfunctional polymerization inhibitor has, in a molecule thereof, two or more radical trapping sites to form a covalent bond by directly connecting with a radical, a lithographic printing plate precursor which is capable of being directly recorded from digital data, for example, of a computer, which has high sensitivity, and which can form an image having a high image quality by preventing an undesirable curing reaction in the non-image area from proceeding, wherein the lithographic printing plate precursor can provide a lithographic printing plate having high printing durability, and a plate making method using the same are provided.. . ... Fujifilm Corporation

07/09/15 / #20150192723

Optical compensation plate

An optical compensation plate comprises a substrate, a phase difference compensation layer, and an antireflection layer. The substrate is for example a glass substrate. ... Fujifilm Corporation

07/09/15 / #20150192715

Heat ray cutting film and method for producing same, and laminated glass and heat ray cutting member

The present invention provides a heat ray cutting film comprising, on a substrate, at least two layers of a light reflecting layer x1 and a light reflecting layer x2 obtained by fixing cholesteric liquid crystalline phases, and an infrared ray absorbing layer comprising composite tungsten oxide microparticles, wherein the light reflecting layer x1 and the light reflecting layer x2 reflect lights circularly polarized in directions opposite to each other, reflection center wavelengths of the light reflecting layer x1 and the light reflecting layer x2 are within a range of 800 to 1100 nm and are substantially equal to each other, and total reflectivity of all light reflecting layers obtained by fixing cholesteric liquid crystalline phases is 80% or more. The heat ray cutting film of the present invention has high transparency and high heat shielding performance.. ... Fujifilm Corporation

07/09/15 / #20150192710

Film mirror and composite film using same

The film mirror includes a resin substrate; a metal reflective layer; and a surface coating layer, and the surface coating layer has a hardness of up to 100 n/mm2 and an elastic recovery rate of 60% or more. The composite film is used in the film mirror. ... Fujifilm Corporation

07/09/15 / #20150192704

Method for producing optical film

The method for producing an optical film includes a film-curing step of curing the coating to form a liquid crystal layer by supporting a second surface of the transparent support by a back-up roller while heating, and irradiating the coating with ultraviolet light, wherein, when an reaching temperature of the transparent support in curing of the coating is set to 80° c. Or higher, and p [n/m2] represents a surface pressure, t [n] represents a tensile force applied to the transparent support, r [m] represents a radius of the back-up roller, l [m] represents a width of the transparent support, and g [gpa] represents an elastic modulus in a width direction of the transparent support at the reaching temperature of the transparent support in curing of the coating, expression (1): p=t/rl and expression (2): p>69/(g−1.5)+400 are satisfied.. ... Fujifilm Corporation

07/09/15 / #20150192684

Radiographic image capturing device, method for acquiring correction data, and computer readable storage medium

A radiographic image capturing device includes: an imaging pixel including a first sensor; a radiation dose detection pixel which including a second sensor; an accumulation control unit that controls such that at least a portion of a duration in which charges generated by the first sensor are being accumulated in the first accumulation section, and at least a portion of a duration in which charges generated by the second sensor are being accumulated in the second accumulation section, overlap with each other; and a correction data acquisition unit that acquires a pixel value of the imaging pixel with a signal level according to an amount of charges accumulated in the first accumulation section as first correction data and that acquires a pixel value of the radiation dose detection pixel with a signal level according to an amount of charges accumulated in the second accumulation section as second correction data.. . ... Fujifilm Corporation

07/09/15 / #20150191652

Liquid crystal composition, method for manufacturing the same, and film

A method for manufacturing a liquid crystal composition, the method including concurrently obtaining a liquid crystal compound represented by the formula (i) and a liquid crystal compound represented by the formula (ii), by allowing a compound represented by the formula (iii) to react with a carboxylic acid represented by the formula (iv) and a carboxylic acid represented by the formula (v), wherein p1 represents a polymerizable group; sp1 represents a c3-12 divalent aliphatic group, etc; t1 represents a 1,4-phenylene group; t2 represents a divalent group having a single bond or cyclic structure; a1 represents —coo—, etc; a2 and a3 represents —oco—, etc; x represents a hydrogen atom, c1-12 alkyl group, etc; y1 and y2 represents o, nr1 or s; r1 represents a hydrogen atom or methyl group; formula (i) p1-sp1-t1-a1-b-a2-t1-sp1-p1; formula (ii) p1-sp1-t1-a1-b-a3-t2-x; formula (iii) being hy1—b—y2h; formula (iv) p1-sp1-t1-cooh; formula (v) x-t2-cooh.. . ... Fujifilm Corporation

07/09/15 / #20150191651

Polymerizable liquid crystal compound, liquid crystal composition, polymer material and method for manufacturing the same, and film

A polymerizable liquid crystal compound represented by the formula (1); wherein a1 represents a c2-18 methylene group, one ch2 or two or more non-adjacent (ch2)s in the methylene group may be substituted by —o—; z1 represents —co—, —o—co— or a single bond; z2 represents —co— or —co—ch═ch—; r1 represents a hydrogen atom or methyl group; r2 represents hydrogen, c1-4 straight-chain alkyl group, c1 or c2 straight-chain alkoxy group, phenyl group, aryloxy group, vinyl group, acryloylamino group, methacryloylamino group, n-aryloxycarbamoyl group, n-alkyloxycarbamoyl group having a c1-4 alkyl group, n-(2-methacryloyloxyethyl)carbamoyloxy group or n-(2-acryloyloxyethyl)carbamoyloxy group; and each of l1, l2, l3 and l4 independently represents c1-4 alkyl group, c1-4 alkoxy group, c2-5 alkoxycarbonyl group, c2-4 acyl group, halogen atom or hydrogen atom, at least one of l1, l2, l3 and l4 represents a substituent other than hydrogen atom.. . ... Fujifilm Corporation

07/09/15 / #20150191613

Ink composition, ink set, and image formation method

Disclosed is an ink composition for ink jet recording containing water, a pigment, a (meth)acrylamide compound, and a polymer particle made of a polymer composed of a structural unit derived from a methacrylic acid and a structural unit derived from methacrylic acid ester having an sp value of from 19.0 mpa1/2 to 25.0 mpa1/2.. . ... Fujifilm Corporation

07/09/15 / #20150191610

Conductive paste and printed wiring board

There are provided a conductive paste which can form a silver layer of excellent migration resistance and conductivity in a simple manner, and a printed wiring board having a silver layer formed of the conductive paste. The conductive paste comprises silver particles and a migration inhibitor, which is present at an amount of 12 parts by mass to 40 parts by mass based on 100 parts by mass of the silver particles and represented by formula (1):. ... Fujifilm Corporation

07/09/15 / #20150191018

Inkjet head cleaning device and cleaning method, and inkjet printing device

An inkjet head cleaning device for an inkjet head having a nozzle surface on which nozzles for ejecting ink are arranged, includes a wiping member traveling unit allowing a wiping member of elongated shape having absorbency to travel along a conveying path in a longitudinal direction, a cleaning liquid supply unit supplying a cleaning liquid to the wiping member, a pressing unit pressing and bringing the wiping member supplied with the cleaning liquid to and into contact with the nozzle surface, and a sliding unit relatively sliding the wiping member and the nozzle surface, in which the nozzle surface is cleaned by putting a state of a mixed liquid of the ink and the cleaning liquid at a contacting portion between the wiping member and the nozzle surface into a state satisfying a predetermined relationship represented by a relationship between a surface tension and viscosity of the mixed liquid.. . ... Fujifilm Corporation

07/09/15 / #20150190762

Membranes

A composite membrane comprising: a.a porous support; b.a polymeric layer comprising dialkylsiloxane groups and a metal, the polymeric layer being present on the porous support; c.a discriminating layer present on the polymeric layer; and d.optionally a protective layer present on the discriminating layer whereinthe polymeric layer has a molar ratio of metal:silicon of at least 0.0005.. . ... Fujifilm Corporation

07/09/15 / #20150190105

Image display system, radiation imaging system, recording medium storing image display control program, and image display control method

An image display system, radiation imaging system, image display control program and image display control method that make the position of an object of interest easier to perceive. A tomographic image generation section generates a tomographic image dg. ... Fujifilm Corporation

07/09/15 / #20150190038

Virtual endoscopic image generation device, method, and medium containing program

A structure extracting unit extracts a structure from a three-dimensional medical image, and a view point determining unit determines a view point position and a direction of line of sight of a virtual endoscopic image. An image generating unit calculates a distance between the view point position and the extracted structure, changes an opacity defined in a color template depending on the distance, and generates, from the three-dimensional medical image, a virtual endoscopic image containing the structure shown according to the color template with the changed opacity viewed from the view point position in the direction of line of sight. ... Fujifilm Corporation

07/02/15 / #20150189194

Radiation imaging system and operation method thereof, and radiation image detecting device and storage medium storing operation program therefor

. . . . . . . . . . In an x-ray imaging system, first x-ray irradiation and second x-ray irradiation are performed in performing x-ray imaging once. A preview producing circuit subjects first image data outputted from a sensor panel after the first x-ray irradiation is finished to binning processing or thinning processing to produce a preview image. ... Fujifilm Corporation

07/02/15 / #20150187472

Magnetic powder for magnetic recording, magnetic recording medium, and method of manufacturing magnetic powder for magnetic recording

An aspect of the present invention relates to magnetic powder, which is magnetoplumbite hexagonal strontium ferrite magnetic powder comprising 0.05 atomic percent to 3 atomic percent of ca per 100 atomic percent of fe, but comprising no rare earth elements or transition metal elements other than fe, the average particle size of which ranges from 10 nm to 25 nm, and which is magnetic powder for magnetic recording.. . ... Fujifilm Corporation

07/02/15 / #20150187380

Magnetic powder for magnetic recording, magnetic recording medium, and method of manufacturing magnetic powder for magnetic recording

An aspect of the present invention relates to magnetic powder, which is magnetoplumbite hexagonal strontium ferrite magnetic powder comprising 1 atomic percent to 5 atomic percent of ba per 100 atomic percent of fe, the average particle size of which ranges from 10 nm to 25 nm, and which is magnetic powder for magnetic recording.. . ... Fujifilm Corporation

07/02/15 / #20150187119

Three-dimensional image display apparatus, method, and program

A structure extraction unit extracts a heart region from a three-dimensional image of a chest, an image display control unit displays a volume rendering of the extracted heart region, an information adding unit adds additional information such as text and voice to a vr image displayed according to desired display conditions which include an image orientation. The display conditions when the additional information is added are stored with the additional information as designated display conditions. ... Fujifilm Corporation

07/02/15 / #20150187118

Three-dimensional image display apparatus, method, and program

A label adding unit adds labels to structures such as a body surface region, a lung region, bronchi, and pulmonary nodules of a human extracted by a structure extraction unit from a three-dimensional image of a chest. An image display control unit displays the three-dimensional image by volume rendering on a display unit. ... Fujifilm Corporation

07/02/15 / #20150187085

Image processing apparatus, method and program

A path detection-use graph structure is generated based on a plurality of nodes representing the plurality of linear structures, and a path that is included in the generated path detection-use graph structure and connects a plurality of root nodes representing points of origin of the plurality of linear structures to each other is detected. Then, based on a predetermined condition representing a feature of an erroneous connection edge erroneously connecting two nodes that are to belong to different graph structures to each other, a connection cost is set for each of edges forming the path so that the erroneous connection edge is hard to connect, and based on the set connection costs, the plurality of graph structures corresponding respectively to the plurality of linear structures are generated.. ... Fujifilm Corporation

07/02/15 / #20150187046

Still image display device and system, and imaging device

A mixture ratio determiner chooses a first mixture ratio set in a case where a blur evaluation value is a reference value or more, and chooses a second mixture ratio set in a case where the blur evaluation value is less than the reference value. The second mixture ratio set has a higher mixture ratio of an in-focus image and a lower mixture ratio of an out-of-focus image than the first mixture ratio set. ... Fujifilm Corporation

07/02/15 / #20150185925

Conductive film, display device and touch panel comprising same, and conductive film pattern determination method

This conductive film has a difference of over 3 cycles/mm between a peak spatial frequency for a plurality of spectral peaks in a two dimensional fourier spectrum for transmittance image data for a wiring pattern and a peak spatial frequency for spectral peaks up to the second term in a two dimensional fourier spectrum for transmittance image data for a microprism array pattern for a prism sheet on the display unit side of a backlight unit, for a first moire obtained by interference between a wiring pattern for a conductive section and the microprism array pattern. As a result, this conductive film is capable of suppressing the occurrence of moire and can greatly improve visibility, even when arranged upon a display unit having a backlight unit using a prism sheet.. ... Fujifilm Corporation

07/02/15 / #20150185612

Actinic ray-sensitive or radiation-sensitive resin composition, resist film, pattern forming method, manufacturing method of electronic device using the same, and electronic device

There is provided an actinic ray-sensitive or radiation-sensitive resin composition comprising: (a) a resin having a repeating unit represented by the specific formula and a group capable of decomposing by an action of an acid to produce a polar group; and an ionic compound represented by the specific formula, and a resist film comprising the actinic ray-sensitive or radiation-sensitive resin composition.. . ... Fujifilm Corporation

07/02/15 / #20150185610

Pattern forming method, actinic ray-sensitive or radiation-sensitive resin composition, resist film, manufacturing method of electronic device using the same, and electronic device

There is provided a pattern forming method comprising, in order, (1) a step of forming a film by using an actinic ray-sensitive or radiation-sensitive resin composition containing (ab) a resin having specific repeating units, (2) a step of exposing the film by using an electron beam or an extreme-ultraviolet ray, and (3) a step of developing the exposed film by using an organic solvent-containing developer to form a negative pattern.. . ... Fujifilm Corporation

07/02/15 / #20150185609

Positive resist composition and method of pattern formation with the same

A positive resist composition comprising: (a) a resin which comes to have an enhanced solubility in an alkaline developing solution by an action of an acid; (b) a compound which generates an acid upon irradiation with actinic rays or a radiation; (c) a fluorine-containing compound containing at least one group selected from the groups (x) to (z); and (f) a solvent, and a method of pattern formation with the composition: (x) an alkali-soluble group; (y) a group which decomposes by an action of an alkaline developing solution to enhance a solubility in an alkaline developing solution; and (z) a group which decomposes by an action of an acid.. . ... Fujifilm Corporation

07/02/15 / #20150185606

Curable composition for photo imprints, method for forming pattern, fine pattern, and method for manufacturing semiconductor device

Provided is a curable composition for photo imprints excellent in the mold releasability and the ink jettability. The curable composition for photo imprints, comprising: a polymerizable compound (a); a photo-polymerization initiator (b); and a mold releasing agent (c), the mold releasing agent (c) being represented by the formula (i) below. ... Fujifilm Corporation

07/02/15 / #20150185585

Imaging device, and focus-confirmation display method

The present invention provide an imaging device that includes an image generation device, a boundary change device configured to change a position of a boundary between the first image and the second image in the second image for display, in a direction orthogonal to the boundary, a selection device configured to select any one of the first image and the second image for each of a plurality of divisions in the second image for display, divided by the boundary changed by the boundary change device, a display device, and a display control device configured to allow the display device to display the first image for display, and allows the second image for display in which a position of the boundary is changed by the boundary change device to be displayed in a display area in the first image for display.. . ... Fujifilm Corporation

07/02/15 / #20150185451

Zoom lens and imaging apparatus

A zoom lens consists of a negative first lens group, a positive second lens group, and a positive third lens group. Upon zooming from the wide angle end to the telephoto end, the first, second, and third lens groups are moved such that distance between the first lens group and the second lens group is reduced, and distance between the second lens group and the third lens group is increased. ... Fujifilm Corporation

07/02/15 / #20150185450

Zoom lens and imaging apparatus

A zoom lens consists of a first lens group having positive refractive power, a second lens group having negative refractive power, a third lens group having positive refractive power, a fourth lens group having negative refractive power, and a fifth lens group having positive refractive power in this order from an object side. The third lens group includes a cemented lens closest to the object side and a cemented lens closest to an image side, and the fourth lens group consists of a negative lens and a positive lens in this order from the object side. ... Fujifilm Corporation

07/02/15 / #20150185437

Wide angle lens and imaging apparatus

A wide angle lens consists of a front group, a stop, and a positive rear group in order from the object side. A positive lens with a convex surface on the object side and a lens having a negative meniscus shape with a convex surface on the object side are respectively disposed first and second from the object side in the front group. ... Fujifilm Corporation

07/02/15 / #20150185387

Polarization film, visible latent image article, and manufacturing method thereof

There is provided a polarization film, a visible latent image article, and a manufacturing method thereof enabling a latent image using a birefringent property to be provided in a visualized state. A polarization film includes a polarization layer transmitting a specific linear polarization component, a circular polarization component, or an elliptical polarization component, and an adhesive layer, a tensile modulus of elasticity e of the polarization film is 0.01 gpa to 7.8 gpa, and a thickness h of the polarization film is 60 μm to 300 μm, and in a visible latent image article which includes the polarization film and the article having a birefringent pattern, the polarization film is peelably affixed to the article having a birefringent pattern through the adhesive layer, and thus a latent image due to the birefringent pattern is visible by the polarization film.. ... Fujifilm Corporation

07/02/15 / #20150185383

Infrared ray cutting film, infrared ray cutting laminated glass, and infrared ray cutting member

An infrared ray cutting film having a transparent base, a near infrared ray absorbing layer containing a compound of formula (1) with a maximum absorption wavelength of from 750 nm to 920 nm, and a near infrared ray reflection layer obtained by fixing a cholesteric liquid crystal phase is excellent in invisibility, robustness and high heat shielding performance. R1a and r1b represent alkyl, aryl or heteroaryl; at least one of r2 and r3 is an electron-withdrawing group, and r4 represents h, alkyl, aryl, heteroaryl, substituted boron, or a metal.. ... Fujifilm Corporation

07/02/15 / #20150184300

Method and device for manufacturing a barrier layer on a flexible substrate

Method and apparatus for manufacturing a barrier layer on a substrate (1; 1a, 1b). An inorganic oxide layer (11) having a pore volume between 0.3 and 10 vol. ... Fujifilm Corporation

07/02/15 / #20150184035

Temporary bonding layer for production of semiconductor device, stack and production method of semiconductor device

As a temporary bonding layer for production of semiconductor device, which not only can temporarily support a member to be processed (for example, a semiconductor wafer) firmly and easily when the member to be processed is subjected to a mechanical or chemical processing, but also can easily release the temporary support for the member processed without imparting damage to the member processed, a stack and a production method of semiconductor device, a temporary bonding layer for production of semiconductor device including (a) a release layer and (b) an adhesive layer, wherein the release layer is a layer containing a hydrocarbon resin is provided.. . ... Fujifilm Corporation

07/02/15 / #20150184033

Temporary adhesive for production of semiconductor device, and adhesive support and production method of semiconductor device using the same

The invention is directed to a temporary adhesive containing (a) a polymer compound having a radical polymerizable group in its side chain, (b) a radical polymerizable monomer, and (c) a heat radical polymerization initiator, and a production method of semiconductor device having a member processed including: adhering a first surface of a member to be processed to a substrate through an adhesive layer formed from the temporary adhesive; conducting a mechanical or chemical processing on a second surface which is different from the first surface of the member to be processed to obtain the member processed; and releasing the first surface of the member processed from the adhesive layer.. . ... Fujifilm Corporation

07/02/15 / #20150184032

Temporary adhesive for production of semiconductor device, and adhesive support and production method of semiconductor device using the same

By a temporary adhesive for production of semiconductor device containing (a) a polymer compound having a thermal decomposition initiation temperature of 250° c. Or more, and (b) a radical polymerizable monomer, and an adhesive support and a production method of semiconductor device using the same, a temporary adhesive for production of semiconductor device, which can temporarily support a member to be processed (for example, a semiconductor wafer) with a high adhesive force even under high temperature condition (for example, at 100° c.) when the member to be processed is subjected to a mechanical or chemical processing, which reduces a problem of generation of gas therefrom in the temporary support even under high temperature condition, and which can easily release the temporary support for the member processed without imparting damage to the member processed, and an adhesive support and a production method of semiconductor device using the same can be provided.. ... Fujifilm Corporation

07/02/15 / #20150184013

Inks for ink-jet printing

An ink composition comprising: a) 0.2 to 20 parts of one or more glycols selected from the group consisting of ethylene glycol, diethylene glycol, propylene glycol or dipropylene glycol; b) 30 to 50 parts of glycerol; c) 0.5 to 10 parts of 2-pyrrolidone; d) 0.5 to 9 parts of colorant; e) 30 to 70 parts of water; f) 0 to 3 parts of surfactant; g) 0 to 5 parts biocide; wherein all parts are by weight. Also ink-sets, printing processes and printed material.. ... Fujifilm Corporation

07/02/15 / #20150183977

Optical film and method for manufacturing same, polarization plate, and liquid crystal display apparatus

The optical film of the present invention is an optical film including a thermoplastic resin, in which the optical film has a moisture permeability of 70 g/m2/day or less (in terms of a film thickness of 40 μm), and contains a moisture permeability-reducing compound having a molecular weight of 200 or more and satisfying formula (1) described below. Formula (1) a/b≦0.9 (a represents a moisture permeability of an optical film in a case in which 10 mass % of the moisture permeability-reducing compound is added to the mass of the thermoplastic resin, and b represents a moisture permeability of an optical film in a case in which the thermoplastic resin is included and the moisture permeability-reducing compound is not added.). ... Fujifilm Corporation

07/02/15 / #20150183154

Bonding method and method of manufacturing microchannel device

A bonding method includes ultrasonically welding a protruding portion extending on a surface of a first substrate member to a surface of a second substrate member by applying ultrasonic vibration to the first substrate member. A protruding stopper portion for stopping welding is provided on the surface of the first substrate member formed with the protruding portion, or on the surface of the second substrate member to come in contact with the protruding portion in a pressed state, to be disposed around the protruding portion in the pressed state. ... Fujifilm Corporation

07/02/15 / #20150182917

Acidic gas separation module, acidic gas separation device, and telescope prevention plate

An acidic gas separation module 10, which improves gas separation efficiency and reduces pressure loss, includes: a permeating gas collecting tube 12 having tube walls in which through holes 12a are formed; a layered body 14 that has at least an acidic gas separation layer 32 and that is wound on the permeating gas collecting tube 12; and telescope prevention plates 18 (a gas supply side 18a and a gas discharge side 18b) provided at both end faces in an axial direction of the wound layered body 14, wherein the ratio (d2/d1) of the open area ratio d2 of the telescope prevention plate on the gas discharge side 18b relative to the open area ratio d1 of the telescope prevention plate on the gas supply side 18a is from 0.5 to 0.9. An acidic gas separation device includes the acidic gas separation module 10.. ... Fujifilm Corporation

07/02/15 / #20150182182

Radiation image detecting device

A sensor panel of an electronic cassette includes detection pixels each for outputting a dose signal corresponding to a dose of x-rays, an irradiation start judging section for judging whether or not x-ray irradiation has been started based on the dose signal, and an aec section for judging whether or not an accumulated dose of x-rays has reached a target dose based on the dose signal. A gain setting section sets a gain of an integration amplifier in the case of using the irradiation start judging section lower than that in the case of using the aec section.. ... Fujifilm Corporation

06/25/15 / #20150181196

Image processing device, imaging device, image processing method, and computer readable medium

. . . . An image processing device includes: a coefficient decision section that, for each of target pixels in a first image and a second image, decides on a parallax conversion coefficient to convert a parallax computed by a parallax computation section into a parallax visually confirmable that the first image and the second image are within the first parallax range in cases determined by a first determination section to be within the first parallax range, and that decides on a parallax conversion coefficient to convert the parallax into a parallax visually confirmable that the first image and the second image are outside the first parallax range in cases determined by the first determination section to be outside the first parallax range; and an image processing section that performs image processing on the target pixels based on the parallax conversion coefficient decided by the coefficient decision section.. . ... Fujifilm Corporation

06/25/15 / #20150181194

Image processing device, imaging device, image processing method, and computer readable medium

There is provided an image processing device, includes: an expansion amount decision section that, for each target pixel for image processing in a first image and a second image, decides on an expansion amount of parallax according to parallax; a coefficient decision section that, for each target pixel for image processing in the first image and the second image, decides on a parallax conversion coefficient for converting the parallax into expanded parallax based on the expansion amount decided by the expansion amount decision section; an image processing section that performs processing on the target pixels to expand parallax based on the parallax conversion coefficient decided by the coefficient decision section; a generation section that generates a first display image based on an image signal, and generates a second display image for use in focus verification based on the first image and the second image.. . ... Fujifilm Corporation

06/25/15 / #20150181127

Image processing device, imaging device, image processing method, and computer readable medium

There is provided an image processing device, includes: a first display image generation section that generates a first display image; a second display image generation section that generates a second display image for use in focus-checking; an acquisition section that acquires color data of the first display image; a determination section that, based on the color data, determines as a display color for the second display image a color with different color characteristics from color characteristics of the first display image; and a display controller that displays on a display section the first display image generated by the first display image generation section, and displays on the display section the second display image generated by the second display image generation section within a display region of the first display image.. . ... Fujifilm Corporation

06/25/15 / #20150181108

Imaging device and focus control method

An imaging device, includes: a sensor including first phase difference detecting pixels arranged in a row direction and second phase difference detecting pixels arranged in the row direction; a defocus amount calculating unit which calculates a correlated amount of a first output signal group and a second output signal group while shifting the first output signal group and the second output signal group in the row direction by an arbitrary amount to calculate a defocus amount from a first shift amount of the first output signal group and the second output signal group when the correlated amount is at a maximum. The defocus amount calculating unit changes an upper limit of a shift amount of the first output signal group and the second output signal group in accordance with at least one of an f value, a focal distance, and a position of a focus lens.. ... Fujifilm Corporation

06/25/15 / #20150179851

Biaxially stretched polyester film for protecting back surface of solar cell, and method for producing polyester resin

A biaxially stretched polyester film for protecting a back surface of a solar cell, containing a polyester resin that is polymerized with addition of a ti catalyst, a mg compound, a p compound and a nitrogen-containing heterocyclic compound, and having a volume resistivity at 285° c. Is 10×107 Ω·cm or less, is improved in hydrolysis resistance and electrostatic adhesion property.. ... Fujifilm Corporation

06/25/15 / #20150179471

Method of producing a semiconductor substrate product and etching liquid

A method of producing a semiconductor substrate product, having the steps of: providing an etching liquid containing water, a hydrofluoric acid compound, and a water-soluble polymer; and applying the etching liquid to a semiconductor substrate, the semiconductor substrate having a silicon layer and a silicon oxide layer, the silicon layer containing an impurity, and thereby selectively etching the silicon oxide layer.. . ... Fujifilm Corporation

06/25/15 / #20150178989

Medical image display apparatus, method, and program

A medical image display apparatus includes a three-dimensional image obtaining unit that obtains a three-dimensional image of a subject, a tubular tissue region obtaining unit that obtains a tubular tissue region representing a tubular tissue of the subject from the three-dimensional image, an endpoint identification unit that identifies, if the tubular tissue region obtained by the tubular tissue region obtaining unit is separated, each endpoint of the two tubular tissue regions connecting to the separating portion, a cross-sectional image generation unit that generates a cross-sectional image that includes the two endpoints identified by the endpoint identification unit, a display control unit that displays the cross-sectional image generated by the cross-sectional image generation unit and a three-dimensional image of the tubular tissue region, and a route receiving unit that receives input of a route connecting the two tubular tissue regions.. . ... Fujifilm Corporation

06/25/15 / #20150178674

Drug inspection support apparatus and method

A drug inspection support apparatus inspects drugs that are prepared based on prescription information and are packaged in a prescription bag. A drug database stores drug master images of drugs that can be prepared. ... Fujifilm Corporation

06/25/15 / #20150178021

Profile providing apparatus, method, and non-transitory computer readable medium

There are provided a profile providing apparatus, a profile providing system, a profile providing method, and a profile providing program that allow providing a profile of the appropriate version while reducing the burden relevant to a setting on the client side. A version selection unit, which selects one of a plurality of versions stored in a profile database as a specific version, and a transmission processing unit, which transmits a profile of the selected specific version to each client apparatus so as to be associated with a unified name that does not depend on the version, are provided.. ... Fujifilm Corporation

06/25/15 / #20150177620

Conductive layer manufacturing method and printed circuit board

In a conductive layer manufacturing method, there is provided a reducing step of irradiating with light a precursor layer-carrying support having a support and a copper oxide particle-containing precursor layer provided on the support so as to reduce copper oxide particles contained in the precursor layer to thereby form a metallic copper-containing conductive layer, and a filling ratio of the copper oxide particles in the precursor layer is at least 65%.. . ... Fujifilm Corporation

06/25/15 / #20150177509

Eyepiece optical system and imaging apparatus

An eyepiece optical system substantially composed of a first lens having a positive refractive power with a convex surface on the eye point side, a second lens having a negative refractive power with a concave surface on the object side, and a third lens having a positive refractive power with an absolute value of radius of curvature of the eye point side surface being smaller than an absolute value of radius of curvature of the object side surface, disposed in order from the object side. The first lens to the third lens are all single lenses and, when the average refractive index of the first lens to the third lens is taken as ndh, the eyepiece optical system satisfies a conditional expression (1): 1.80<ndh.. ... Fujifilm Corporation

06/25/15 / #20150177500

Zoom lens and imaging apparatus

A zoom lens consists of a first lens group having positive refractive power, a second lens group having negative refractive power, a third lens group having positive refractive power, a fourth lens group having positive refractive power, and a fifth lens group having positive refractive power in this order from an object side. The third lens group consists of a 3-1st lens group having positive refractive power and a 3-2nd lens group having negative refractive power in this order from the object side. ... Fujifilm Corporation

06/25/15 / #20150177495

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is substantially constituted by five lenses, including: a first lens having a positive refractive power and a convex surface toward the object side; a second lens having a negative refractive power and a concave surface toward the image side; a third lens having a negative refractive power and a concave surface toward the object side; a fourth lens having a positive refractive power and is of a meniscus shape with a concave surface toward the object side; and a fifth lens having a negative refractive power and is of a meniscus shape having a convex surface toward the image side, provided in this order from the object side. The imaging lens satisfies a predetermined conditional formula.. ... Fujifilm Corporation

06/25/15 / #20150177494

Imaging lens and imaging apparatus

An imaging lens composed of six lenses of a negative first lens, a positive second lens, a negative third lens, a positive fourth lens, a positive fifth lens, and a negative sixth lens, disposed in order from the object side, and when refractive indices of the third lens to the sixth lens are taken as nd3 to nd6 respectively, the imaging lens satisfies conditional expressions (1): nd3<21 1.7, (2): nd4<1.6, (3):nd5<1.6 and (4): nd6<1.89.. . ... Fujifilm Corporation

06/25/15 / #20150177492

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is substantially constituted by five lenses, including: a first lens having a positive refractive power and a convex surface toward the object side; a second lens having a biconcave shape; a third lens having a positive refractive power and is of a meniscus shape having a concave surface toward the object side; a fourth lens having a concave surface toward the object side; and a fifth lens having a negative refractive power and is of a meniscus shape having a convex surface toward the object side, provided in this order from the object side. The imaging lens satisfies a predetermined conditional formula.. ... Fujifilm Corporation

06/25/15 / #20150175969

Polypeptide, scaffold composition, composition for cartilage tissue restoration, composition for cartilage cell culture, and composition for promoting glycosaminoglycan production

A polypeptide having an amino acid sequence in which the number of rgd sequences contained per molecular weight of 10 kda is not less than 0.30; the number of gfpger sequences contained per molecular weight of 10 kda is not less than 0.15; and the number of gvmgfp sequences contained per molecular weight of 10 kda is less than 0.30; is provided. A scaffold composition, a composition for repairing a cartilage tissue, a composition for culturing cartilage cells, and a composition for promoting glycosaminoglycan production, which compositions contain the above polypeptide, are also provided.. ... Fujifilm Corporation

06/25/15 / #20150174897

Assistance device, design assistance method and recording medium for liquid ejection device, method of manufacturing liquid ejection device, and image recording device

A design assistance method for a liquid ejection device includes an acquiring step of acquiring a pulsation frequency fp of a liquid pressure applying unit, a compliance capacity c of a pressure absorber, and a composite inertance l of a liquid ejection head and a liquid supply flow channel; a determining step of determining whether a relationship between a cutoff frequency fc expressed by fc=1/(2π(lc)0.5) using the acquired c and l, and the pulsation frequency fp satisfies a predetermined relationship that satisfies fp≧fc; and an outputting step of outputting a determination result in the determining step.. . ... Fujifilm Corporation

06/25/15 / #20150173702

Integrated multi-rail imaging system

The imaging system can comprise a plurality of elongated rails, a scanhead assembly, and a small animal mount assembly. The scanhead assembly is selectively mounted onto a first rail and is constructed and arranged for movement in a linear bi-directional manner along the longitudinal axis of the first rail. ... Fujifilm Corporation

06/25/15 / #20150173626

Photoacoustic measurement apparatus and probe for photoacoustic measurement apparatus

The light irradiation range of a probe for a photoacoustic measurement apparatus is increased. The probe for a photoacoustic measurement apparatus includes a light transmission unit that irradiates a subject with light, and a photoacoustic wave detector 52 that detects a photoacoustic wave generated from the subject. ... Fujifilm Corporation

06/25/15 / #20150173625

High frequency ultrasound transducers

High frequency ultrasound transducers configured for use with photoacoustics systems are disclosed herein. In one embodiment, an ultrasound transducer stack includes a transducer layer and an at least partially optically reflective lens layer. ... Fujifilm Corporation

06/18/15 / #20150172642

Stereo image display apparatus and stereo image display method

. . . . . . . . . . . . A stereo image display apparatus that causes a display device to display a stereo image having a parallax, wherein a stereo image of a currently displayed frame is advanced frame by frame to a stereo image of the next frame in response to a frame-by-frame advance indication, the apparatus comprising: a frame-by-frame advancing device that, once frame-by-frame advance is indicated, switches the stereo image of the current frame on the display with a parallaxless image of the current frame, thereafter advances the image frame by frame to display a parallaxless image of the next frame, and further thereafter displays a stereo image of the next frame on the display device, wherein the frame-by-frame advancing device performs the frame-by-frame advance with sliding-out/sliding-in.. . ... Fujifilm Corporation

06/18/15 / #20150172615

Image processing apparatus, method, recording medium and image pickup apparatus

Calculation of gr and gb color ratios in a local area uses a weighted average filter having weighting coefficients where the ratio of total sums of weighting coefficients for g and r pixels is 1:1, and weighted average filter having weighting coefficients where the ratio of total sum of weighting coefficients for g and b pixels is 1:1, respectively, on pixel lines in a horizontal direction and a vertical direction in a kernel. R and b pixel values are then calculated by interpolating the pixel value of a pixel to be processed with the g pixel value at the pixel position to be subjected to a demosaic process and the color ratio.. ... Fujifilm Corporation

06/18/15 / #20150172614

Image processing device, imaging apparatus, computer, image processing method, and non-transitory computer readable medium

An image enlargement processing portion 16 of the image processing device includes a data acquisition section 70 which judges whether or not photographing condition data is included in the image photographing data, and for acquiring content of the photographing condition data in a case where it is judged that the photographing condition data is included in the input image photographing data, and an enlargement process determination section 72 which determines a process parameter for an enlargement process for generating enlarged image data from the imaging data, in which the photographing condition data includes information regarding presence or absence of an optical low-pass filter during creation of the imaging data or information regarding an array of color filters of an imaging portion used to create the imaging data.. . ... Fujifilm Corporation

06/18/15 / #20150172537

Photographing apparatus, method and program

Processing for judging whether a face is included in a frame is performed, in a predetermined interval, on each of frames included in a moving image of a subject, displayed on a monitor, until the judgment becomes positive. If it is judged that a face is included in a frame, the facial position is detected in the frame, and stored. ... Fujifilm Corporation

06/18/15 / #20150172532

Imaging device and focusing-verification display method

An imaging device comprising an image generation unit, a difference-emphasis processing unit, a display unit, a display controller that displays the first display image on the display unit and displays the second display image having been subjected to the difference-emphasis processing by the difference-emphasis processing unit in a displayed area of the first display image, and a calculation unit that calculates a parallax between the first pixel in the first image and the second pixel in the second image corresponding to the first pixel, wherein the difference-emphasis processing unit determines whether the parallax between the first image and the second image is large or small on the basis of the parallax calculated by the calculation unit, and performs the difference-emphasis processing on the basis of a result of determination whether the parallax is large or small.. . ... Fujifilm Corporation

06/18/15 / #20150171660

Charging device, electronic equipment, and charging situation notifying method

A charging system 100 includes an electronic equipment 1 and a charging device 2. The charging device 2 includes a control unit 22 that controls a magnetic field generated from a variable magnetic field generating unit 25 which generates a variable magnetic field, and the control unit 22 controls a strength of the magnetic field generated from the variable magnetic field generating unit 25, in accordance with a remaining capacity or an available charging free capacity in a battery 11 of the electronic equipment 1 receiving a power transmitted from a feed circuit 21.. ... Fujifilm Corporation

06/18/15 / #20150171526

Cable connector and endoscope apparatus

A cable connector includes a circuit board, having a predetermined width in a manner passable through an elongated tube of an endoscope apparatus, disposed to extend in an axial direction. A terminal group is formed on the circuit board, for electrically contacting a socket connector. ... Fujifilm Corporation

06/18/15 / #20150171313

Forming a device having a curved piezoelectric membrane

Processes for forming an actuator having a curved piezoelectric membrane are disclosed. The processes utilize a profile-transferring substrate having a curved surface surrounded by a planar surface to form the curved piezoelectric membrane. ... Fujifilm Corporation

06/18/15 / #20150170373

Drug inspection apparatus and method

A drug inspection apparatus inspects drugs that are prepared based on prescription information and are packaged in a prescription bag. A drug database includes drug images of drugs that can be prepared. ... Fujifilm Corporation

06/18/15 / #20150169944

Image evaluation apparatus, image evaluation method, and non-transitory computer readable medium

A plurality of images are grouped using imaging date and time in supplementary information of an image. The number of images included in each group becomes importance, and images belonging to a group of which the importance is equal to or more than a threshold are evaluation targets in an image evaluation apparatus. ... Fujifilm Corporation

06/18/15 / #20150169113

Transfer material, manufacturing method of electrostatic capacitance type input device, electrostatic capacitance type input device, and image display device including the same

To provide a transfer material which is capable of improving the visibility of a transparent electrode pattern of an electrostatic capacitance type input device, and is capable of improving the productivity of the electrostatic capacitance type input device. A transfer material includes a temporary supporter and a transparent curable resin layer laminated on the temporary supporter, and a refractive index of the transparent curable resin layer at a wavelength of 550 nm is 1.55 or more.. ... Fujifilm Corporation

06/18/15 / #20150169111

Capacitance type touch panel, manufacturing method of the same, and input device

A capacitance type touch panel includes: an insulating layer; a plurality of electrode portions; a plurality of lead-out wiring portions; a transparent resin layer; and a substrate disposed on the transparent resin layer, wherein at least on the surface of the peripheral edge of the transparent resin layer exposed between the insulating layer and the substrate and on the exposed surface of the lead-out wiring portions, a sealing layer is disposed, and the sealing layer has a moisture vapor transmittance equal to or less than 20 g/m2/24 h/atm (25° c., 90% rh, 25 μm), and has a thickness equal to or greater than 1.0 μm.. . ... Fujifilm Corporation

06/18/15 / #20150168838

Positive resist composition, resin used for the positive resist composition, compound used for synthesis of the resin and pattern forming method using the positive resist composition

A positive resist composition comprises: (a) a resin of which solubility in an alkali developer increases under an action of an acid; (b) a compound capable of generating an acid upon irradiation with actinic rays or radiation; (c) a resin having at least one of a fluorine atom and a silicon atom; and (d) a solvent; and a pattern forming method using the positive resist composition.. . ... Fujifilm Corporation

06/18/15 / #20150168834

Pattern forming method, electron beam-sensitive or extreme ultraviolet ray-sensitive resin composition, resist film, and method for manufacturing electronic device, and electronic device using the same

There is provided a pattern forming method, including: (a) forming a film by using an electron beam-sensitive or extreme ultraviolet ray-sensitive resin composition containing a resin (a) having a repeating unit represented by formula (1-0) and a repeating unit represented by formula (1-2); (b) exposing the film by using an electron beam or extreme ultraviolet ray; and (c) developing the exposed film by using a developer containing an organic solvent to form a negative pattern, wherein a content of the repeating unit represented by formula (1-0) is 45 mol % or more based on a whole repeating units in the resin (a).. . ... Fujifilm Corporation

06/18/15 / #20150168694

Wide angle lens and imaging apparatus

A wide angle lens consists of a negative first lens group, a positive second lens group, a stop, and a positive third lens group in order from the object side. The first lens group includes two negative meniscus lenses, each with a convex surface on the object side. ... Fujifilm Corporation

06/18/15 / #20150168693

Imaging lens and imaging apparatus equipped with the same

An imaging lens consists of a front group and a rear group. The front group is composed of a lens having a negative meniscus shape with a convex surface on the object side, a negative lens, a negative lens, and a positive lens in order from the object side. ... Fujifilm Corporation

06/18/15 / #20150168690

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is essentially constituted by five lenses, including: a first lens of a biconvex shape; a second lens of a meniscus shape having a concave surface toward the image side; a third lens of a biconcave shape; a fourth lens of a meniscus shape having a convex surface toward the image side; and a fifth lens of a biconcave shape having at least one inflection point on the surface thereof toward the image side, provided in this order from the object side.. . ... Fujifilm Corporation

06/18/15 / #20150168688

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is essentially constituted by five lenses, including: a first lens having a positive refractive power and is of a meniscus shape with a convex surface toward the object side; a second lens of a biconcave shape; a third lens of a biconcave shape; a fourth lens of a meniscus shape with a convex surface toward the image side; and a fifth lens of a biconcave shape having at least one inflection point on the surface thereof toward the image side, provided in this order from the object side. The imaging lens satisfies predetermined conditional formula (2).. ... Fujifilm Corporation

06/18/15 / #20150168687

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is essentially constituted by five lenses, including: a first lens having a positive refractive power and a convex surface toward the object side; a second lens having a concave surface toward the image side; a third lens having a negative refractive power and a concave surface toward the image side; a fourth lens having a convex surface toward the image side; and a fifth lens of a biconcave shape, provided in this order from the object side. The imaging lens satisfies a predetermined conditional formula.. ... Fujifilm Corporation

06/18/15 / #20150168686

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens, substantially consisting of six lenses, composed of a first lens having a positive refractive power and a meniscus shape with a convex surface on the object side, a second lens having a negative refractive power, a third lens having a positive refractive power, a fourth lens having a positive refractive power, a fifth lens having a negative refractive power and a biconcave shape, and a sixth lens having a negative refractive power, disposed in order from the object side.. . ... Fujifilm Corporation

06/18/15 / #20150168678

Imaging lens and imaging apparatus

An imaging lens consists of a first lens-group consisting of a positive lens with its surface that has the smaller absolute value of a curvature-radius facing an object-side, a positive lens in meniscus-shape with its convex-surface facing the object-side, a positive lens with its surface that has the smaller absolute value of a curvature-radius facing the object-side, and a negative lens with its surface that has the smaller absolute value of a curvature-radius facing an image-side, an aperture stop, a second lens-group consisting of a negative lens with its surface that has the smaller absolute value of a curvature-radius facing the object-side, a positive lens with its surface that has the smaller absolute value of a curvature-radius facing the image-side, and a positive lens, and a third lens-group consisting of a positive lens and a negative lens in this order from the object-side. A predetermined conditional expression is satisfied.. ... Fujifilm Corporation

06/18/15 / #20150166819

Image forming method

An image forming method comprises: applying a treatment liquid, which contains an organic acidic compound represented by the following general formula (i), a water-soluble polymer compound, and water, on a recording medium; and applying an ink composition, which contains a pigment, a pyrrolidone derivative, a compound represented by the following general formula (ii), and water, on a treatment liquid-applied surface of the recording medium. In the general formula (i), n represents an integer of 2 or greater and m represents an integer of 3 or greater. ... Fujifilm Corporation

06/18/15 / #20150166816

Dispersion composition, curable composition using the same, transparent film, microlens, and solid-state imaging device

There is provided a dispersion composition capable of forming a film being excellent in surface conditions, the dispersion composition containing metal oxide particles (a) having a primary particle diameter of 1 nm to 100 nm, a polymer compound (b) having an acid value of less than 120 mgkoh/g, which is represented by the following formula (1), and a solvent (c).. . ... Fujifilm Corporation

06/18/15 / #20150166780

Dispersion composition, and curable composition, transparent film, microlens and solid-state imaging device using same, and polymer compound

There is provided a dispersion composition containing (a) a metal oxide particle having a primary particle diameter of 1 nm to 100 nm, (b) a polymer compound represented by the specific formula having a weight average molecular weight of 5,000 to 8,000 and an acid value of 70 to 90 mgkoh/g, and (c) a solvent, and a curable composition containing the dispersion composition and (d) a polymerizable compound.. . ... Fujifilm Corporation

06/18/15 / #20150166561

Organic thin film transistor, organic semiconductor thin film, and organic semiconductor material

An organic thin film transistor having a semiconductor active layer containing a compound represented by the formula (1) has a high carrier mobility and a small change in the threshold voltage after repeated operation. R1 to r10 represent h or a substituent, provided that at least one of r1 to r4 and r6 to r9 represents a substituent represented by -l-r, l represents a specific divalent linking group, and r represents an alkyl group, an oligooxyethylene group, an oligosiloxane group, or a trialkylsilyl group.. ... Fujifilm Corporation

06/18/15 / #20150166560

Organic thin film transistor, organic semiconductor thin film, and organic semiconductor material

An organic thin film transistor having a semiconductor active layer containing a compound represented by the formula (1) has a high carrier mobility and a small change in the threshold voltage after repeated operation. R1 to r10 represent h or a substituent, provided that any two adjacent members among r1 to r4 and r6 to r9 are bonded to each other to form a substituted or unsubstituted benzene ring.. ... Fujifilm Corporation

06/18/15 / #20150165784

Liquid droplet ejecting apparatus

The present invention provides a liquid droplet ejecting apparatus that may cool, with a simple configuration, drive sections of piezoelectric elements. Namely, the liquid droplet ejecting apparatus has head modules that use piezoelectric elements to eject ink droplets, driver ics that drive the piezoelectric elements, a ventilation unit that delivers dry air to the environs of the piezoelectric elements via a gas delivery passage disposed therein in order to dehumidify the environs of the piezoelectric elements, a branch tube that branches from the gas delivery passage and blows onto the driver ics some of the air that has been delivered, and a duckbill valve that is disposed in the branch tube. ... Fujifilm Corporation

06/18/15 / #20150165470

Die coater and method for producing coated film

The present invention provides a die coater which can improve a distribution of film thickness in the width direction of a coating, and can reduce the length of an end part of the coating, and a method for producing a coated film. The die coater includes: a main body of a die block, which has a manifold and a slit that communicates with the manifold and discharges a coating liquid therefrom; and spacers that are arranged on each of both end parts in a width direction of the slit and define a width of a flow channel of the coating liquid, wherein an area of a notch region in each spacer is larger than an area of a virtual triangle.. ... Fujifilm Corporation

06/18/15 / #20150165384

Composite for carbon dioxide separation, module for carbon dioxide separation and method for producing composite for carbon dioxide separation

Disclosed is a composite for carbon dioxide separation, containing, in the following order, a gas permeable support; a carbon dioxide separation layer containing a water absorptive polymer and a carbon dioxide carrier; a steam permeable porous protective layer having an average thickness of from 1 μm to 500 μm; and a supplied gas passage member.. . ... Fujifilm Corporation

06/18/15 / #20150165369

Process for preparing membranes

A process for preparing a composite membrane comprising the steps of: a) applying a radiation-curable composition to a porous support; b) irradiating the composition and thereby forming a layer of cured polymer of thickness 20 to 400 nm on the support; c) forming a discriminating layer on the layer of cured polymer; and d) optionally forming a protective layer on the discriminating layer; wherein the radiation-curable composition comprises a partially crosslinked, radiation-curable polymer comprises dialkylsiloxane groups. Composite membranes are also claimed.. ... Fujifilm Corporation

06/18/15 / #20150165001

Bone regeneration agent including gelatin

It is an object of the present invention to provide a bone regeneration agent and a bone supplementation formulation, in which a supplementation material itself is capable of promoting bone regeneration. The present invention provides a bone regeneration agent which comprises a gelatin having an amino acid sequence derived from a partial amino acid sequence of collagen.. ... Fujifilm Corporation

06/18/15 / #20150164462

Radiographic image capturing apparatus

The radiographic imaging device that configures the disclosed radiographic imaging system has at least a camera that images a main cassette body. Said camera is integrally configured to a radiation source and a control device that controls the main cassette body or is integrally configured to a main radiation source body that houses the radiation source.. ... Fujifilm Corporation

06/18/15 / #20150164461

Electronic radiography system and signal relay device

A signal relay device comprises a first connection i/f, to which an emission switch is connected, a second connection i/f, to which an emission signal i/f of an electronic cassette is connected, and a third connection i/f, to which a switch i/f of a source control device is connected, and a signal processing unit. The signal processing unit generates an emission execution signal during a time period in which an emission command signal from the emission switch and an emission enable signal from the electronic cassette are inputted. ... Fujifilm Corporation

06/18/15 / #20150164459

Communication control method and radiographic imaging apparatus and system

An x-ray imaging apparatus includes a detection panel for receiving x-rays transmitted through an object after emission from an x-ray source, and converting an x-ray image of the object into an electric signal. An aec signal output device detects a dose of the x-rays and outputs an aec signal for exposure control of the x-ray image. ... Fujifilm Corporation

06/18/15 / #20150164458

Radiation image detecting device

A sensor panel of an electric cassette is provided with detection pixels for aec to stop x-ray irradiation when an accumulated dose of the x-rays reaches a target dose. A plurality of small blocks each containing a plurality of the detection pixels for calculating the accumulated dose are disposed in each of a plurality of large blocks obtained by dividing an imaging area. ... Fujifilm Corporation

06/11/15 / #20150163388

Imaging lens barrel and method for controlling operation of the same

. . An imaging lens barrel includes: a barrel body; a rotating body including a first magnetic scale and a second magnetic scale; a magnetic sensor device including a first magnetic sensor and a second magnetic sensor; a phase difference calculation section configured to calculate a phase difference between a first phase signal and a third phase signal; a correction table memory configured to store a correction table storing a correction value for correcting a difference between the phase difference and a design value in association with the phase difference; a phase difference correction section configured to read a correction value corresponding to the phase difference calculated by the phase difference calculation section and to correct the phase difference using the read correction value; and an absolute position calculation section configured to calculate an absolute position of the imaging lens.. . ... Fujifilm Corporation

06/11/15 / #20150161333

Clinical information display apparatus, method and program

When pieces of clinical-data registered on registration-dates, respectively, and the registration-dates are stored for each clinical-item, and clinical-data for each of the clinical-items are displayed on a display screen, a latest registration-date or a date on which the clinical-data are displayed on the display screen is set, as an initial-display-base-date, and initial display of the clinical-data is performed. A user's input of selecting one of the registration-dates is received, and the selected-registration-date is set, as a selected-display-base-date. ... Fujifilm Corporation

06/11/15 / #20150160559

Pattern forming method, method for manufacturing electronic device, and electronic device

There is provided a pattern forming method containing: forming a film by using a radiation-sensitive or actinic ray-sensitive resin composition containing: (a) a onium salt compound containing a nitrogen atom in a cationic moiety; (b) a compound capable of generating an acid upon irradiation with an actinic ray or radiation; and (c) a resin capable of increasing the polarity by the action of an acid to decrease solubility in a developer containing an organic solvent, exposing the film; and developing the exposed film by using a developer containing an organic solvent to form a negative pattern.. . ... Fujifilm Corporation

06/11/15 / #20150160555

Pattern forming method, and, method for producing electronic device and electronic device, each using the same

The pattern forming method of the invention includes (i) a step of forming a first film on a substrate using an actinic ray-sensitive or radiation-sensitive resin composition including a resin (a) capable of increasing the polarity by the action of an acid to decrease the solubility in a developer including an organic solvent; (ii) a step of exposing the first film; (iii) a step of developing the exposed first film using a developer including an organic solvent to form a negative tone pattern; and (iv) a step of forming a second film on the second substrate so as to cover the periphery of the negative tone pattern.. . ... Fujifilm Corporation

06/11/15 / #20150160452

Optical element and image display device

An optical element including a cell a cell, the cell including: a first substrate, at least a portion of at least one surface of the first substrate being electroconductive; a second substrate disposed so as to face the electroconductive surface of the first substrate; an electrically non-conductive oil and an electroconductive hydrophilic liquid that are provided between the electroconductive surface of the first substrate and the second substrate; and a hydrophobic insulating film that is provided at at least a portion of the electroconductive surface side of the first substrate, that contacts the oil, and that includes a crosslinked structure derived from a siloxane compound having an unsaturated double bond, the profile of an interface between the oil and the hydrophilic liquid changing according to a voltage applied across the hydrophilic liquid and the electroconductive surface of the first substrate.. . ... Fujifilm Corporation

06/11/15 / #20150160444

Zoom lens and imaging apparatus

A zoom lens consists essentially of a positive first lens group, a negative second lens group, a negative third lens group, and a positive fourth lens group. During zooming from the wide angle end to the telephoto end, the first lens group and the fourth lens group are fixed, the third lens group is moved monotonously from the object side to the image side, and the second lens group is moved to correct an image plane variation associated with the zooming when the amounts of movements of the second lens group and the third lens group are taken as m2 and m3 respectively, the zoom lens satisfies a conditional expression (1): 0<m2/m3<1.0, where each of m2 and m3 is given a positive sign for a movement to the image side.. ... Fujifilm Corporation

06/11/15 / #20150160443

Imaging lens and imaging apparatus

An imaging lens consists of a front group having positive refractive power as a whole and a rear group in this order from an object side. The front group consists of three positive lenses, a negative lens with its concave surface facing an image side, a positive lens with its convex surface facing the object side, a negative lens with its concave surface facing the image side, a stop, a negative lens with its concave surface facing the object side and plural positive lenses in this order from the object side. ... Fujifilm Corporation

06/11/15 / #20150160429

Imaging lens barrel and method for controlling operation of the same

An imaging lens barrel includes: a barrel body; a rotating body; a magnetic sensor device; a phase difference calculation section; a correction table memory; a phase difference correction section configured to, when a relative position between the rotating body and the magnetic sensor device according to a posture of the imaging lens barrel is different from that of when a correction table is created, correct a phase difference calculated by the phase difference calculation section according to the relative position and to correct the phase difference calculated by the phase difference calculation section, using a correction value corresponding to the corrected phase difference, and to, when the relative position is not different from that of when the correction table is created, correct the calculated phase difference, using a correction value corresponding to the phase difference calculated by the phase difference calculation section; and an absolute position calculation section.. . ... Fujifilm Corporation

06/11/15 / #20150160427

Imaging lens barrel and method for controlling operation of the same

An imaging lens barrel includes: a barrel body; a rotating body; a first magnetic sensor; a second magnetic sensor; a phase difference calculation section; a correction table memory that stores a plurality of correction tables which are obtained when the imaging lens is moved at different speeds and are used to correct a difference between the phase difference calculated by the phase difference calculation section and a design value of the phase difference; a phase difference correction section configured to correct the phase difference calculated by the phase difference calculation section, using a correction table corresponding to a moving speed of the imaging lens among the plurality of correction tables; and an absolute position calculation section.. . ... Fujifilm Corporation

06/11/15 / #20150160168

Light source unit and photoacoustic measurement apparatus using the same

It is desirable to more stably and efficiently transmit light in a housing of a light source unit. A light source unit 13, which emits a laser beam l to a light guide part 40, includes: a unit housing 13b that includes a connector receiving portion 51b detachably connected to a connector portion 51a; a light source 30 that is installed in the unit housing 13b and outputs the laser beam l; a diffusion part 80 that diffuses the laser beam l output from the light source 30; a condensing lens system 81 that condenses the laser beam l diffused by the diffusion part 80; and an optical fiber 82a that transmits the laser beam l, which is condensed by the condensing lens system 81, to the connector receiving portion 51b. ... Fujifilm Corporation

06/11/15 / #20150159125

Cleaning formulation for removing residues on surfaces

This disclosure relates to a cleaning composition that contains 1) hf; 2) substituted or unsubstituted boric acid; 3) ammonium sulfate; 4) at least one metal corrosion inhibitor; 5) water; and 6) optionally, at least one ph adjusting agent, the ph adjusting agent being a base free of a metal ion. This disclosure also relates to a method of using the above composition for cleaning a semiconductor substrate.. ... Fujifilm Corporation

06/11/15 / #20150159124

Cleaning formulation for removing residues on surfaces

This disclosure relates to a cleaning composition that contains 1) at least one redox agent; 2) at least one first chelating agent, the first chelating agent being a polyaminopolycarboxylic acid; 3) at least one second chelating agent different from the first chelating agent, the second chelating agent containing at least two nitrogen-containing groups; 4) at least one metal corrosion inhibitor, the metal corrosion inhibitor being a substituted or unsubstituted benzotriazole; 5) at least one organic solvent selected from the group consisting of water soluble alcohols, water soluble ketones, water soluble esters, and water soluble ethers; 6) water; and 7) optionally, at least one ph adjusting agent, the ph adjusting agent being a base free of a metal ion. This disclosure also relates to a method of using the above composition for cleaning a semiconductor substrate.. ... Fujifilm Corporation

06/11/15 / #20150159032

Curable resin composition, water-soluble ink composition, ink set, and image-forming method

A curable resin composition comprises fine particles, a polymerizable compound having an ethylenic unsaturated group, a photopolymerization initiator having a betaine structure; and water.. . ... Fujifilm Corporation

06/11/15 / #20150158987

Cellulose acylate film, polarizing plate and liquid crystal display device

Provided is a cellulose acylate film that barely causes display unevenness when the cellulose acylate film is incorporated into a liquid crystal display. The cellulose acylate film includes a cellulose acylate having a total degree of acyl substitution of 2.0 to 2.35 and having a thickness of 20 to 39 μm. ... Fujifilm Corporation

06/11/15 / #20150158315

Print medium-conveying device and inkjet printing device

There is provided a print medium-conveying device and an inkjet printing device that can convey a print medium without causing wrinkles, float and damage. In an embodiment, the front surface of paper passed to an image recording drum is pressed by a pressure roller, and is made to contact the peripheral surface of the image recording drum. ... Fujifilm Corporation

06/11/15 / #20150157980

Acidic gas separation module, and method for manufacturing acidic gas separation module

An acidic gas separation module including: a perforated hollow central tube; and a layered body that is wound on the perforated hollow central tube and has, in the following order on a porous support: an acidic gas separation layer containing a water-absorbing polymer, a carrier, and water; and a flow channel material with a network structure having a thread intersection portion and an arithmetical surface roughness for a surface contacting the acidic gas separation layer in the thread intersection portion of 35 μm or less. The acidic gas separation module suppresses generation of flocculated water by maintaining the generation of turbulent flow in the flow channel material, effectively suppresses damage to the surface of the acidic gas separation layer by the flow channel material in the winding-on process during manufacture, and exhibits excellent acidic gas separation efficiency.. ... Fujifilm Corporation

06/11/15 / #20150157280

Image display apparatus and program

A linked switching partial area and a non-linked switching partial area are set in at least one display area in which a tomogram is to be displayed. When an input operation giving an instruction to switch the tomogram is performed in the non-linked switching partial area, only the image displayed in the display area is switched. ... Fujifilm Corporation

06/04/15 / #20150156478

Imaging device

. . . . An imaging device includes a multifocal main lens having different focal distances for a plurality of regions, an image sensor having a plurality of pixels configured of two-dimensionally arranged photoelectric converting elements, a multifocal lens array having a plurality of microlens groups at different focal distances disposed on an incident plane side of the image sensor, and an image obtaining device which obtains from the image sensor, a plurality of images for each of the focal distances obtained by combining the multifocal main lens and the plurality of microlens groups at different focal distances.. . ... Fujifilm Corporation

06/04/15 / #20150156405

Imaging device and method for controlling same

An imaging device comprising a photographing lens, an imaging element; a first interpolation device, a second interpolation device, a focusing confirmation image generation device configured to at least generate a first image and a second image respectively from the pixel values of the first and second interpolation pixels calculated by the first and second interpolation device and generating a focusing confirmation image based on the first and second images, and a display device configured to display the focusing confirmation image generated by the focusing confirmation image generation device.. . ... Fujifilm Corporation

06/04/15 / #20150155152

Mass spectrometry apparatus

The mass spectrometry apparatus is constituted by a sample plate to which a measurement target substance is adhered, the sample plate being transparent to a laser beam; a support mount on which the sample plate is placed, a part of the support mount being a light transmitting portion that transmits a laser beam; a light irradiation unit that exposes the measurement target substance to a laser beam from the back side of the sample plate and is provided with a laser source that outputs a laser beam, a collecting lens that collects a laser beam onto the measurement target substance, and an aberration-correction mechanism that corrects aberration which occurs when the laser beams are collected; and a detector that detects the measurement target substance which has been desorbed from the surface of the sample plate and ionized, by being irradiated with a laser beam.. . ... Fujifilm Corporation

06/04/15 / #20150154922

Liquid crystal display device

A liquid crystal display device comprising a liquid crystal panel, a backlight, a liquid crystal panel drive controller, and a backlight drive controller determining a luminance pattern defining a magnitude of luminance of each of the plurality of illumination parts on the basis of luminance information corresponding to each area to perform an area control for separately controlling the luminances of the plurality of illumination parts in accordance with the luminance pattern, the backlight drive controller having a special area control mode for performing the area control by determining the luminance pattern common to a plurality of frames of the image displayed on the display region, wherein the backlight drive controller, in the special area control mode, performs computation of an average value of the luminances of respective pixels of the image on the basis of the image signal for the plurality of frames to determine the luminance pattern.. . ... Fujifilm Corporation

06/04/15 / #20150154919

Display device

The present invention provides a display device that can suppress the unevenness of reflection brilliance due to the glare of an outside light on a display surface, and can achieve the enhancement of the visibility of a display image. For preventing the unevenness of the reflection brilliance due to the glare of the outside light on the front surface of the display of the display device, a display device according to an aspect of the present invention corrects the display brilliance of the display image on the display and suppresses the unevenness. ... Fujifilm Corporation

06/04/15 / #20150153464

Radiographic image capturing device, method for detecting radiation doses, and computer readable storage medium

A radiographic image capturing device includes: plural radiation dose detection pixels that respectively output signal values according to a dose of irradiated radiation; a determination unit that determines a presence or absence of defects, block-by-block, based on signal values of radiation dose detection pixels included in each of plural blocks, which are arranged such that the respective blocks include at least a portion of the plural radiation dose detection pixels; a block rearrangement unit that performs block rearrangement to change the arrangement of the plural blocks according to a determination result of the determination unit; and a detection unit that detects a dose of irradiated radiation based on signal values of each arranged block or of each rearranged block.. . ... Fujifilm Corporation

06/04/15 / #20150153284

Optical field enhancement device, light measurement apparatus and method

An optical field enhancement device that generates an enhanced optical field on a surface of a metal film by an optical field enhancement effect of localized plasmon induced on the surface of the metal film by light projected onto a nanostructure on which the metal film is formed, the device including a transparent substrate having a transparent nanostructure on a surface, a metal film formed on a surface of the nanostructure, and a support member for supporting a subject at a position spaced apart from the surface of the metal film.. . ... Fujifilm Corporation

06/04/15 / #20150153006

Damage evident transducer cable

A medical cable that has been potentially damaged due to a severe bend, kink or other trauma, produces a visual indication of a location where the cable may have been damaged. In one embodiment, the cable is formed from a hollow tube where the walls of the tube contain dye-filled capsules or microspheres that break if subjected to trauma. ... Fujifilm Corporation

06/04/15 / #20150152131

Synthetic intermediate of 1-(2-deoxy-2-fluoro-4-thio-ß-d-arabinofuranosyl)cytosine, synthetic intermediate of thionucleoside, and method for producing the same

A compound represented by a formula [1d] as shown below (wherein r1a, r1b, r2a, r2b, r3a and r3b represent a hydrogen atom, an optionally substituted c1-6 alkyl group, and the like) is useful as an intermediate for producing a thionucleoside, and the production method of the present invention is useful as a method for producing a thionucleoside.. . ... Fujifilm Corporation

06/04/15 / #20150151535

Image forming apparatus

An image forming apparatus that forms an image where occurrence of concentration unevenness caused by occurrence of mechanical crosstalk is suppressed are provided. According to the present invention, the distance from the boundary position of the inkjet head corresponding to the concentration boundary between the first concentration region and the second concentration region to the second concentration region end of the inkjet head is less than the reciprocal of the spatial frequency of the concentration unevenness. ... Fujifilm Corporation

06/04/15 / #20150151244

Acidic gas separation module and production method therefor, acidic gas separation layer, production method and facilitated transport membrane therefor, and acidic gas separation system

Provided is an acidic gas separation module 10 which contains: a permeated gas collection tube 12 having through-hole 12as formed on the wall thereof; a layered body 14 in which a feed gas flow path member 30 through which an acidic gas-containing source gas is fed, an acidic gas separation layer 32 that contains a carrier reacting with the acidic gas and a hydrophilic compound supporting the carrier, and a permeated gas flow path member 36 through which the acid gas that has reacted with the carrier and permeated through the acidic gas separation layer 32 flows toward the through-hole 12as are layered; and heat/moisture-resistant adhesive parts 34 and 40 which adhere the both side edges of the acidic gas separation layer 32 and the permeated gas flow path member 36 along the circumferential direction in a state where the layered body 14 is wound in layers on the permeated gas collection tube 12, the adhesive parts 34 and 40 also adhering the circumferential direction edges of the acidic gas separation layer 32 and the permeated gas flow path member 36.. . ... Fujifilm Corporation

06/04/15 / #20150150465

Photoacoustic image generation apparatus and method

After light has been output to a subject to be examined, a photoacoustic wave induced in the subject by the output light is detected. It is assumed that at least one virtual detector element is present outside of a real detector, and dummy data corresponding to the at least one virtual detector element are added to photoacoustic data in which pieces of data of the photoacoustic wave detected by the detector are arranged in accordance with the positions of detector elements. ... Fujifilm Corporation

05/28/15 / #20150149214

Clinical information display apparatus, method and program

. . . . . . . . When plural clinical-items are classified as a major clinical-item or as a related clinical-item and clinical-data of the major clinical-item or items are mainly displayed in initial display, whether each of related clinical-items includes clinical-data judged as data that need to be displayed is decided by judging whether each of at least one set of clinical-data belonging to each of the related clinical-items needs to be displayed by using a whether-to-display judgment criterion for judging whether to display that has been set in advance. In initial display, clinical-data of the related clinical-item that has been decided as a related clinical-item including the clinical-data that need to be displayed are displayed in addition to clinical-data of the major clinical-item or items, but no clinical-data of the related clinical-item that has been decided as a related clinical-item including no clinical-data that need to be displayed are displayed.. ... Fujifilm Corporation

05/28/15 / #20150149213

Medical care information display control apparatus, method, and medium

A medical care information display control apparatus, including a medical care item selection receiving unit that receives a selection of any of a plurality of medical care items, a medical care item sorting unit that sorts out a medical care item having medical care data with values that satisfy a similarity condition preset based on medical care data values of the selected medical care item from the plurality of medical care items, and a display control unit that graph displays only the medical care data of the selected medical care item and the medical care data of the sorted out medical care item, among medical care data of the plurality of medical care items, in the same display area using axes of the same scale.. . ... Fujifilm Corporation

05/28/15 / #20150148608

Switching valve unit and endoscope apparatus

In an endoscope apparatus, a suction button unit (switching valve unit) includes a valve cylinder, a piston rod, a cap device and seal packing. Holes are formed in a piston chamber of the valve cylinder, including a discharge port hole, a suction port hole and an exhaust port hole. ... Fujifilm Corporation

05/28/15 / #20150148598

Wire driver for wire line and endoscope

A side-viewing endoscope includes an elongated tube for entry in a body cavity for imaging. A wire line is contained in the elongated tube, for moving in an axial direction back and forth. ... Fujifilm Corporation

05/28/15 / #20150147699

Pattern forming method, actinic ray-sensitive or radiation-sensitive resin composition, resist film, method for manufacturing electronic device, and electronic device

The pattern forming method of the present invention includes (i) forming a film using an actinic ray-sensitive or radiation-sensitive resin composition which contains a resin (a) which has a repeating unit including a group capable of generating a polar group by being decomposed due to an action of an acid and a repeating unit including a carboxyl group, a compound (b) which generates an acid according to irradiation with actinic rays or radiation, and a solvent (c); (ii) exposing the film using a krf excimer laser, extreme ultraviolet rays, or an electron beam; and (iii) forming a negative tonetone pattern by developing the exposed film using a developer which includes an organic solvent.. . ... Fujifilm Corporation

05/28/15 / #20150147688

Pattern forming method, actinic ray-sensitive or radiation-sensitive resin composition, resist film, manufacturing method of electronic device using the same, and electronic device

There is provided a pattern forming method comprising (1) a step of forming a film by using an actinic ray-sensitive or radiation-sensitive resin composition containing (p) a resin having a repeating unit represented by the specific formula, (2) a step of exposing the film by using an actinic ray or radiation, and (3) a step of developing the exposed film by using an organic solvent-containing developer to form a negative pattern, wherein the content of the repeating unit represented by the specific formula is 25 mol % or more based on all repeating units in the resin (p).. . ... Fujifilm Corporation

05/28/15 / #20150147001

Image editing apparatus, image editing method, and non-transitory storage medium

An imposing apparatus searches for a layout of objects whose profile shapes (profile lines) do not overlap each other with respect to each of cells that make up an imposition area. The imposing apparatus then adjusts an interval between the objects that have been laid out according to the search result, by a unit smaller than the unit length of the cells, thereby bringing the profile lines of adjacent ones of the objects into partial agreement with each other.. ... Fujifilm Corporation

05/28/15 / #20150146864

Radiation imaging apparatus

A cassette holder of an imaging stand is provided with first and second catch members for catching and holding an electronic cassette from above and below. The first catch member has a multi connector connected to a multi terminal of the electronic cassette. ... Fujifilm Corporation

05/28/15 / #20150146309

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is substantially constituted by six lenses, including: a first lens having a positive refractive power and a convex surface toward the object side; a second lens having a negative refractive power; a third lens having a negative refractive power; a fourth lens having a positive refractive power; a fifth lens having a negative refractive power; and a sixth lens having a biconcave shape, provided in this order from the object side.. . ... Fujifilm Corporation

05/28/15 / #20150146120

Nozzle face wiping device and image recording device

The present invention provides a nozzle face wiping device and an image recording device that can switch whether to wipe out a nozzle face by a simple mechanism. According to one mode of the present invention, it is possible to brake the running of the wiping web by the braking device on the upstream side (supply shaft side) of the pressure member. ... Fujifilm Corporation

05/28/15 / #20150146088

Interchangeable lens camera, camera body, lens unit, and busy signal control method

An aspect of the present invention provides an interchangeable lens camera having a camera body and a lens unit that is freely attachable and detachable to the camera body. In the interchangeable lens camera, a communications unit in the camera body sends via communications terminals (mt_mosi and mt_miso) an intr_busy control instruction that instructs whether to make notification with a busy signal (intr_busy signal) for any operation out of a plurality of types of operations that can be executed, and the lens unit or camera body communications unit sets the busy signal (intr_busy) to an on state (low level) only during the period of operation of the type indicated by the intr_busy control instruction.. ... Fujifilm Corporation

05/28/15 / #20150146052

Imaging device and automatic focus adjustment method

The present invention utilizes color mixings with angle dependencies from adjacent r pixels, and in the case where a subject color is red, uses first and second b pixels as phase-difference pixels, allowing for an accurate phase-difference af based on the output signals of the first and second b pixels. Here, it is unnecessary to provide phase-difference pixels dedicated to the case where the subject color is red, and the phase difference is detected using ordinary b pixels of an imaging element. ... Fujifilm Corporation

05/28/15 / #20150146049

Image processing device, image pickup device, computer, image processing method and non transitory computer readable medium

An image reduction processing section 16 includes a data acquisition section 70 that acquires whether shooting condition data is included in image capture data (including image pickup data) 30 and contents of the shooting condition data, and reduction processing discrimination unit for discriminating at least any of whether reduction association processing (such as low-pass filter processing) associated with reduction processing of generating reduced image data from the image pickup data is executed, a processing parameter (such as a cutoff frequency of low-pass filter processing) of the reduction association processing, and a processing parameter (such as a reduction ratio) of the reduction processing, on the basis of an acquisition result of the shooting condition data. The shooting condition data includes information on the presence or absence of the optical low-pass filter and information on the array of the color filters.. ... Fujifilm Corporation

05/28/15 / #20150143995

Gas separation membranes with intermixed layers

A composite membrane comprising: a) a porous support; b) a gutter layer; and c) a discriminating layer; wherein at least 10% of the discriminating layer is intermixed with the gutter layer.. . ... Fujifilm Corporation

05/21/15 / #20150142788

Repair information management apparatus, repair information management system, and repair information management method

. . . . A database stores a parts list, a tools and materials list, a repair information list, and an equipment list. The parts list and the tools and materials list are associated with regulation information, which indicates that the parts, the tools, and the materials are subject to a regulation, and updated every time a new regulation is imposed. ... Fujifilm Corporation

05/21/15 / #20150141831

Ultrasonic inspection apparatus

An ultrasonic inspection apparatus includes: a probe; a transmission unit configured to cause the probe to transmit a ultrasonic beam; a reception unit configured to receive analog element signals output by the probe; an a/d conversion unit configured to perform a/d conversion on the analog element signal to obtain first element data; and a data processing unit configured to generate second element data from a plurality of the pieces of first element data, wherein the data processing unit changes conditions of acquisition of two or more of the pieces of first element data for generating the second element data depending on a depth of a position in which the second element data is obtained.. . ... Fujifilm Corporation

05/21/15 / #20150140484

Actinic ray-sensitive or radiation-sensitive resin composition, resist film, using the same, pattern forming method, manufacturing method of electronic device, and electronic device

There is provided an actinic ray-sensitive or radiation-sensitive resin composition comprising: (a) a resin containing a repeating unit represented by the first specific formula and a repeating unit represented by the second specific formula, wherein the content of the repeating unit represented by the first specific formula is 35 mol % or more based on all repeating units in the resin (a), a resist film formed using the actinic ray-sensitive or radiation-sensitive resin composition.. . ... Fujifilm Corporation

05/21/15 / #20150140482

Pattern forming method, and, electronic device producing method and electronic device, each using the same

A pattern forming method includes: (a) forming a first film on a substrate using an actinic ray-sensitive or radiation-sensitive resin composition (i) containing a resin of which solubility in a developer containing an organic solvent decreases due to polarity increased by an action of an acid; (b) exposing the first film; (c) developing the exposed first film using a developer containing an organic solvent to form a first negative pattern; (e) forming a second film on the substrate using an actinic ray-sensitive or radiation-sensitive resin composition (ii) containing a resin of which solubility in a developer containing an organic solvent decreases due to polarity increased by an action of an acid; (f) exposing the second film; and (g) developing the exposed second film using a developer containing an organic solvent to form a second negative pattern in this order.. . ... Fujifilm Corporation

05/21/15 / #20150139399

Radiographic imaging device, radiographic imaging system, computer-readable medium storing radiographic imaging program, and radiographic imaging method

The present invention provides a radiographic imaging device including: a detecting section that detects a dose of radiation that has been irradiated when imaging a radiographic image corresponding to irradiated radiation; and a determining section that determines whether the radiographic image is a valid image on the basis of the dose of radiation that has been detected by the detecting section.. . ... Fujifilm Corporation

05/21/15 / #20150139398

Radiation image detecting device, radiation imaging system and operation method thereof

In capturing an image of a grid by an image detector, a measurement pixel that is not in the position of a specific point having a maximum or minimum value of an output signal is referred to as a first measurement pixel, and a measurement pixel that is in the position of the specific point is referred to as a second measurement pixel. The disposition of the first and second measurement pixels are determined so as to satisfy the following condition: fg/fn≠odd number, wherein fg is a grid frequency and fn is a nyquist frequency of pixels; and in shifting the grid c times by one pixel, the number of the first measurement pixels is larger than that of the second measurement pixels at any time in the range of a cycle c of a repetition pattern appearing in the image.. ... Fujifilm Corporation

05/21/15 / #20150138602

Imposing apparatus, imposing method, and non-transitory storage medium

An imposing apparatus determines at least one pair of line components included in positioning marks based on the positional relationship between particular line components in a page region, and estimates marking positions for the positioning marks based on the shape of the pair of line components. The imposing apparatus acquires the marking positions as positional information of a page box in association with the page region.. ... Fujifilm Corporation

05/21/15 / #20150138437

Drive device which can be freely attached to/detached from lens barrel, and process control method and adjustment method for same

There are provided a drive device that is detachably mounted on a lens barrel making time, which is required until the position of a zoom ring is detected, uniform, a method of controlling initial processing for storing a result of initial processing in a memory, and a method of adjusting an angular position. A series of pulses are output from an encoder 45 according to the rotation of a zoom ring. ... Fujifilm Corporation

05/21/15 / #20150138409

Camera and method of controlling operation of same

An image obtained by superimposing the image of the subject, which is displayed on the display screen of an electronic viewfinder, upon the optical image of the subject can be seen by the user looking through a finder unit. Display position on the display screen of the electronic viewfinder is shifted so as to correct for parallax between the finder unit and the solid-state electronic image sensing device. ... Fujifilm Corporation

05/21/15 / #20150138398

Image processing system, transmitting-side device and receiving-side device

Provided is an image processing system capable of coping with data which is obtained in a new color filter array, and making full use of the performance of a receiving-side device by reducing the influence of a difference in the performance of the receiving-side device on an image quality. An image processing system 100 includes a transmitting-side device 101 and a receiving-side device 102. ... Fujifilm Corporation

05/21/15 / #20150138294

Medium-holding device, medium-conveying device, and inkjet recording device

The present invention provides a medium-holding device capable of setting a suction pressure for each of various areas within a suction-holding surface, a medium-conveying device, and an inkjet recording device. In an embodiment of the invention, a cover is attached to a main body formed into a drum shape such that a surface of the cover functions as the suction-holding surface for a paper sheet. ... Fujifilm Corporation

05/21/15 / #20150137601

Power supply management method for electronic device, and electronic device and power supplying device

A power supply management method for electronic devices includes: an electric power transmission step of wirelessly transmitting electric power to each of electronic devices 50, 60 placed on a table 10 from a power supplying device 20 contained in the top plate of the table 10; a step of receiving electric power transmitted from the power supplying device 20 by each of the electronic devices 50, 60; and a step of activating the system of each of the electronic devices by the electronic devices 50, 60 when the electric power is received from the power supplying device 20 and an amount of the received electric power is equal to or larger than a threshold value for system activation.. . ... Fujifilm Corporation

05/21/15 / #20150137108

Functional film and organic el device

A functional film of the present invention includes a support body of which a retardation value is less than or equal to 300 nm; a protective inorganic layer which is formed on the support body; one or more combinations of an inorganic layer and an organic layer which are formed on the protective inorganic layer; and a mixed layer having a thickness of 1 to 100 nm which is formed between the support body and the underlying inorganic layer, and is mixed with a component of the support body and a component of the protective inorganic layer.. . ... Fujifilm Corporation

05/21/15 / #20150135979

Lithographic printing plate support, lithographic printing plate support manufacturing method and lithographic printing plate precursor

A lithographic printing plate support of the invention includes an aluminum plate and an anodized aluminum film which has micropores extending from a surface of the anodized film opposite from the aluminum plate in a depth direction of the anodized film; the micropores each have a large-diameter portion extending from the anodized film surface to an average depth (depth a) of 75 to 120 nm and a small-diameter portion which communicates with the bottom of the large-diameter portion; the average diameter of the large-diameter portion at the anodized film surface is at least 10 nm but less than 30 nm; a ratio of the depth a to the average diameter (depth a/average diameter) of the large-diameter portion is more than 4.0 but up to 12.0; and an average diameter of the small-diameter portion at the communication level is more than 0 but less than 10 nm.. . ... Fujifilm Corporation

05/07/15 / #20150127462

Information distribution method, information distribution server, and charging device

. . An information distribution server 50 acquires owner information on owners of a plurality of electronic devices 1 charged by a charging device 20 from the electronic devices 1 through the charging device 20, determines a configuration of a group constituted by a plurality of owners who are charging the electronic devices 1 by the charging device 20, by using the plurality of pieces of acquired owner information, acquires information corresponding to the determined configuration of the group from a database 40 that stores information according to a configuration of a group constituted by a plurality of owners, and causes the acquired information to be transmitted to the electronic devices 1 charged by the charging device 20 from the charging device 20.. . ... Fujifilm Corporation

05/07/15 / #20150126594

Liquid composition containing taxane-based active ingredient, process for producing same, and liquid preparation

A liquid composition which includes a taxane-based active ingredient (a) selected from the group consisting of docetaxel and a derivative thereof; at least one glycol (b); and at least one surfactant component (c) selected from the group consisting of a polysorbate, a polyoxyethylene glycol ester, and a polyoxyethylene castor oil derivative, in which a volume ratio of the glycol (b) to the surfactant component (c) is in a range of form 45/55 to 55/45, and a total content of the glycol (b) and the surfactant component (c) with respect to a total volume of the liquid composition is 95% (v/v) or more.. . ... Fujifilm Corporation

05/07/15 / #20150125362

Developed-color measurement apparatus and method

Judgment as to whether an analyte is present is performed before a washing step in which a washing liquid for washing a test area and the vicinity of the test area is supplied to a test strip. If the analyte is detected, the judgment ends, but if the analyte is not detected, judgment is performed again after the test area and the vicinity of the test area are washed.. ... Fujifilm Corporation

05/07/15 / #20150125078

Image deformation apparatus and method of controlling operation of same

A target image is deformed in such a manner that a subject in a reference image and a subject in the target image will coincide. A reference image and a target image are each divided into regions that conform to amounts of optical distortion. ... Fujifilm Corporation

05/07/15 / #20150124342

Lens device

An object is to provide a lens device that can share a cable and can prevent the unnecessary exposure of the cable, and an imaging apparatus that includes the lens device. A lens device according to an embodiment of the invention, includes a lens barrel, a control unit that is provided on the lens barrel, a cable of which one end is connected to the control unit and the other end is connected to the imaging apparatus main body, and a housing portion in which the cable is wound and housed and which is provided with an opening through which the cable is led out. ... Fujifilm Corporation

05/07/15 / #20150124333

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is substantially constituted by six lenses, including: a negative first lens having a concave surface toward the object side; a positive second lens; a negative third lens; a positive fourth lens of a meniscus shape with a concave surface toward the object side; a fifth lens; and a sixth lens having a concave surface toward the image side, the surface toward the image side thereof being an aspherical shape having at least one inflection point thereon, provided in this order from the object side. The imaging lens satisfies a predetermined conditional formula.. ... Fujifilm Corporation

05/07/15 / #20150124332

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is constituted essentially by six lenses, including: a negative first lens having a concave surface toward the object side; a positive second lens; a negative third lens; a negative fourth lens of a meniscus shape with a concave surface toward the object side; a fifth lens; and a sixth lens having a concave surface toward the image side, the surface toward the image side thereof being an aspherical shape having at least one inflection point thereon, provided in this order from the object side.. . ... Fujifilm Corporation

05/07/15 / #20150124152

Near-infrared absorptive composition, near-infrared cut filter using near-infrared absorptive composition, method for manufacturing near-infrared cut filter, and camera module and method for manufacturing camera module

Provided is a near-infrared absorptive compositions which having excellent near-infrared shielding property even if they are formed into thin films, being able to apply, and inhibited transmittance of visible light loss and transmittance loss after postbaking even if they contain a higher proportion of solids such as copper complexes. The near-infrared absorptive composition comprising a copper complex, a polyfunctional polymerizable compound and a solvent, wherein the near-infrared absorptive composition has a solids content of 35 to 90% by mass.. ... Fujifilm Corporation

05/07/15 / #20150124131

Camera and method of controlling operation of same

The image in an electronic viewfinder is made larger than the image in an optical viewfinder. Specifically, a finder unit is provided with a region that displays a portion of the display screen of an electronic viewfinder alongside a region that displays the optical image of a subject. ... Fujifilm Corporation

05/07/15 / #20150124129

Imaging device, and image processing method

According to the present invention, since a color image for a moving image including that for live view display includes image data on pixel lines including first and second phase difference pixels, phase difference af can be accurately performed during the moving image taking. A color image for the moving image includes not only the image data on the pixel lines including the first and second phase difference pixels, but also image data on pixel lines that do not include the first and second phase difference pixels and only include normal pixels. ... Fujifilm Corporation

05/07/15 / #20150124015

Drive apparatus for liquid ejection head, liquid ejection apparatus and inkjet recording apparatus

A drive apparatus for a liquid ejection head, includes a drive signal generating device for generating a drive signal to operate an ejection energy generating element provided so as to correspond to a nozzle of the liquid ejection head, the drive signal being supplied to the ejection energy generating element so that a liquid droplet is caused to be ejected from the nozzle, wherein: the drive signal includes a plurality of ejection pulses for performing a plurality of ejection operations during one recording period, in a remaining pulse sequence excluding a final pulse of the plurality of ejection pulses, a voltage amplitude of a subsequent pulse is smaller than a voltage amplitude of a preceding pulse, and the final pulse has a largest voltage amplitude, of the plurality of ejection pulses.. . ... Fujifilm Corporation

05/07/15 / #20150123607

Charging support method, charging support management device, and charging support system

A system 100 includes a plurality of electronic apparatuses 1 which have a function of feeding power of a battery 11 to other electronic apparatuses and a function of receiving power from other electronic apparatuses and charging the battery 11, a management server 50, and a database 40. The management server 50 records, in the database 40, positional information of power feedable electronic apparatuses 1 which permit a power feed to other electronic apparatuses, acquires positional information of a power feed-desiring electronic apparatus 1 which desires a power feed from other electronic apparatuses, specifies a power feedable electronic apparatus 1 in the periphery of the power feed-desiring electronic apparatus 1 using the acquired positional information and the positional information of the power feedable electronic apparatuses 1 in the database 40, and transmits the positional information of the specified electronic apparatus 1 to the power feed-desiring electronic apparatus 1.. ... Fujifilm Corporation

05/07/15 / #20150123026

Magnetic powder for magnetic recording medium

Provided is magnetic powder capable of enhancing simultaneously both magnetic characteristics including snp and durability of a magnetic recording medium. The hexagonal ferrite magnetic powder for a magnetic recording medium has a ba/fe molar ratio of 8.0% or more, a bi/fe molar ratio of 2.5% or more and an al/fe molar ratio of from 3.0 to 6.0%. ... Fujifilm Corporation

04/30/15 / #20150120579

Repair information management apparatus, repair information management system, and repair information management method

. . In a repair information management apparatus, a term correspondence table is stored in a database. In the term correspondence table, each term (word) to be displayed on a repair information input screen for inputting repair information is associated with country-specific terms, being translations of the term in two or more languages. ... Fujifilm Corporation

04/30/15 / #20150120318

Apparatus for managing repair information of medical equipment, method for operating the same, and repair information management system

A repair information management apparatus, which manages repair information of endoscopes, receives repair information of an endoscope from a user terminal in a repair center where a repair technician repairs the endoscope, and stores the repair information for each repair. When the user terminal requests for a skill evaluation screen of a specific repair technician, the repair information management apparatus reads out the repair information of the repairs performed by the repair technician and generates the skill evaluation screen and delivers it to the user terminal. ... Fujifilm Corporation

04/30/15 / #20150118860

Etching method, and method of producing semiconductor substrate product and semiconductor device using the same

An etching method, having the step of applying an etching liquid onto a tin-containing layer in a semiconductor substrate thereby etching the tin-containing layer, the etching liquid comprising water, and a basic compound and an oxidizing agent in water thereof to be within the range of ph from 8.5 to 14, and the tin-containing layer having a surface oxygen content from 0.1 mol % to 10 mol %.. . ... Fujifilm Corporation

04/30/15 / #20150118628

Actinic-ray- or radiation-sensitive resin composition, actinic-ray- or radiation-sensitive film therefrom, method of forming pattern, process for manufacturing semiconductor device, and semiconductor device

Provided is an actinic-ray- or radiation-sensitive resin composition including a resin (p) comprising any of repeating units (a) of general formula (i) below, each of which contains an ionic structural moiety that when exposed to actinic rays or radiation, is decomposed to thereby generate an acid in a side chain of the resin.. . ... Fujifilm Corporation

04/30/15 / #20150118627

Pattern forming method, composition used tehrein, method for manufacturing electronic device, and electronic device

A pattern forming method includes: (i) a step of forming a first film by using an actinic ray-sensitive or radiation-sensitive resin composition (i), (ii) a step of exposing the first film, (iii) a step of developing the exposed first film by using an organic solvent-containing developer to form a negative pattern, (iv) a step of forming a second film on the negative pattern by using a specific composition (ii), (v) a step of increasing polarity of the specific compound present in the second film, and (vi) a step of removing a specific area of the second film by using the organic solvent-containing remover.. . ... Fujifilm Corporation

04/30/15 / #20150118621

Method of forming pattern and actinic-ray- or radiation-sensitive resin composition for use in the method

Provided is a method of forming a pattern, including (a) forming a film comprising an actinic-ray- or radiation-sensitive resin composition comprising a resin (p) containing a repeating unit (p1) with a cyclic carbonic acid ester structure and any of repeating units (p2) of general formula (p2-1) below, and a compound (b) that when exposed to actinic rays or radiation, generates an acid, (b) exposing the film to actinic rays or radiation, and (c) developing the exposed film with a developer comprising an organic solvent to thereby obtain a negative pattern.. . ... Fujifilm Corporation

04/30/15 / #20150118451

Ink composition, image forming method, printed material, and graft copolymer

An ink composition includes a graft copolymer including a repeating unit having a partial structure represented by formula (1) described below and a repeating unit having a hydrophilic group in which a graft chain includes the repeating unit and water.. . ... Fujifilm Corporation

04/30/15 / #20150117832

Imaging device, and image processing method

One aspect of the present invention thinning-reads pixel signals from the multiple pixels according to a thinning pattern from an image pickup element, or extracts pixel signals from the multiple pixels according to the thinning pattern from a color image that is read from the image pickup element and corresponds to the color filter array, and acquires a thinned color image. Then, moving image data is generated on the basis of the thinned color image. ... Fujifilm Corporation

04/30/15 / #20150116848

Imaging lens and imaging apparatus

An imaging lens consists of a first lens group, a second lens group, an aperture stop and a third lens group that has positive refractive power in this order from an object side. The first lens group consists of an l11 lens having positive refractive power, an l12 lens having negative refractive power, an l13 meniscus lens having negative refractive power with its concave surface facing an image side, an l14 lens having negative refractive power with its concave surface facing the object side and two or three lenses, each having positive refractive power, in this order from the object side. ... Fujifilm Corporation

04/30/15 / #20150116649

Light reflection layer, light reflection plate, laminated interlayer film sheet for laminated glass, laminated glass, and method of manufacturing these

A light reflection layer, comprising a first liquid crystal layer obtained by fixing a first curable liquid crystal composition through curing in a state of a cholesteric liquid crystal phase, wherein the first curable liquid crystal composition contains a polymerizable liquid crystal compound, a fluoroalkyl group-containing alignment control agent, and a hydrophilic group-containing coating property imparting agent exhibits low haze, excellent heat shielding properties and improved coating properties when the light reflection layer obtained by fixing the cholesteric liquid crystal phase on the light reflection layer is laminated and coated.. . ... Fujifilm Corporation

04/30/15 / #20150116560

Camera and method of controlling operation of same

An image of a subject formed optically by a objective lens (concave lens) and an eyepiece lens can be seen by a pupil. A light shielding plate is provided in front of part of the objective lens and a shielded region is formed by the light shielding plate. ... Fujifilm Corporation

04/30/15 / #20150116555

Color imaging element and imaging device

According to a color imaging element and an imaging device of the present invention, because one or more pixels of first filters corresponding to transparence are disposed within a pixel line of each direction of a first direction to a fourth direction of a color filter array, it is possible to acquire brightness information in a high frequency range with high precision and reduce occurrence of a false color (color moire), thereby obtaining image data with excellent resolution. Further, because one or more pixels of the first filters corresponding to transparence are disposed within the pixel line of each direction of the first direction to the fourth direction, it is possible to realize color filters with excellent optical sensitivity.. ... Fujifilm Corporation

04/30/15 / #20150116554

Color imaging element and imaging device

In the color imaging element and the imaging device according to an aspect of the present invention, a basic array pattern is repeatedly placed in a first direction and in a second direction, the basic array pattern includes four or more rectangular patterns each corresponding to 3×2 pixels each composed of a first filter, a color filter array includes therein grating filter lines surrounding the four directions of the rectangular pattern, the color filter array includes therein the first filters each disposed in each line in the first direction, in the second direction, in a third direction, and in a fourth direction, and the basic array pattern includes therein one or more second filters of each color, each disposed in each line in the first direction in the second direction.. . ... Fujifilm Corporation

04/30/15 / #20150116423

Nozzle face cleaning device and image recording device

A nozzle face cleaning device and an image recording device includes: a wiping member; cleaning liquid adding means which adds a cleaning liquid to the wiping member; pressing means that brings the wiping member to which the cleaning liquid has been added, into pressure-contact with a nozzle face; and wiping means which makes the wiping member and an ejection head relatively move, and wipes the nozzle face. A cleaning liquid supply flow channel is opened to the air in a connected portion of the cleaning liquid supply flow channel and a cleaning liquid adding nozzle.. ... Fujifilm Corporation

04/30/15 / #20150116389

Image display apparatus and method

When an environment to appreciate an image displayed on an lcd panel is a normal environment, bld control is performed according to the second backlight brightness characteristic in which the display brightness in the lcd panel is close to be linear, when it is a dark environment, bld control is performed according to the first backlight brightness characteristic in which the backlight brightness of the low brightness part of the image is set lower than the second backlight brightness characteristic, and, when it is a bright environment, bld control is performed according to the third backlight brightness characteristic in which the backlight brightness of the medium brightness part of the image is set higher than the second backlight brightness characteristic.. . ... Fujifilm Corporation

04/30/15 / #20150116270

Transparent laminate, capacitance type input device, and image display device

Provided is a transparent laminate which does not have a problem in which a transparent electrode pattern is visually recognized, a capacitance type input device having the transparent laminate, and an image display device provided with the capacitance type input device as a constituent element. The transparent laminate of the invention includes a region where a transparent substrate, a first transparent film which contains a metal oxide and has a film thickness of 55 nm to 110 nm, a transparent electrode pattern, and a second transparent film which contains 5 mass % to 80 mass % of metal oxide particles and has a film thickness of 55 nm to 110 nm are laminated in this order in a plane.. ... Fujifilm Corporation

04/30/15 / #20150114243

Cylindrical printing plate precursor and process for producing same, and cylindrical printing plate and process for making same

A cylindrical printing plate precursor of the present invention comprising a cured resin sheet formed into a cylindrical shape, the cylindrical printing plate precursor comprising an overlap margin part comprising opposite end parts of the cured resin sheet superimposed on one another, each end part of the cured resin sheet in the overlap margin part having a thickness that is smaller than the thickness of the cured resin sheet other than in the overlap margin part, and a joining part, in the overlap margin part, in which a hole providing communication between the opposite end parts of the cured resin sheet is filled with a cured resin, the overlap margin part having a specific width, the joining part having a specific size, and the joining part having a specific cross-sectional area in the plate surface direction.. . ... Fujifilm Corporation

04/23/15 / #20150112198

Ultrasound diagnostic apparatus and data processing method

. . . . . . There is provided an ultrasound diagnostic apparatus capable of outputting an appropriate ultrasound image with no distortion regardless of a sound velocity distribution in a subject. In the ultrasound diagnostic apparatus, sound velocities are calculated at two or more points in a subject, and coordinate transformation of a generated ultrasound image is performed based on the calculated sound velocities.. ... Fujifilm Corporation

04/23/15 / #20150112138

Hood for endoscope, endoscope and method of fixing balloon for endoscope

A hood for an endoscope has a tube shape and is fitted to an end of an insertion part of the endoscope. A base end of the hood is fitted to a forward end of a first balloon. ... Fujifilm Corporation

04/23/15 / #20150111804

Cleaning formulations for removing residues on surfaces

This disclosure relates to a cleaning composition that contains 1) at least one chelating agent, the chelating agent being a polyaminopolycarboxylic acid; 2) at least one organic solvent selected from the group consisting of water soluble alcohols, water soluble ketones, water soluble esters, and water soluble ethers; 3) at least one monocarboxylic acid containing a primary or secondary amino group and at least one additional basic group containing nitrogen; 4) at least one metal corrosion inhibitor, the metal corrosion inhibitor being a substituted or unsubstituted benzotriazole; and 5) water. This disclosure also relates to a method of using the above composition for cleaning a semiconductor substrate.. ... Fujifilm Corporation

04/23/15 / #20150111157

Method of forming pattern and actinic-ray- or radiation-sensitive resin composition for use in the method

Provided is a method of forming a pattern, including forming a film comprising an actinic-ray- or radiation-sensitive resin composition comprising, resin (a) comprising any of repeating units of general formula (i) below, which resin when acted on by an acid, decreases its solubility in a developer comprising an organic solvent, and a compound (b) expressed by any of general formulae (b-1) to (b-3) below, which compound when exposed to actinic rays or radiation, generates an acid, exposing the film to actinic rays or radiation, and developing the exposed film with a developer comprising an organic solvent to thereby obtain a negative pattern.. . ... Fujifilm Corporation

04/23/15 / #20150111154

Pattern forming method, actinic ray-sensitive or radiation-sensitive resin composition, resist film, method of manufacturing electronic device, and electronic device

There is provided a pattern forming method including: (a) a process of forming a film by resin (p) having a repeating unit (a) having a cyclic structure and a partial structure represented by the following formula (i), (ii-1) or (ii-2), and a repeating unit (b) having a group which decomposes by the action of an acid to generates a polar group, and an actinic ray-sensitive or radiation-sensitive resin composition containing compound (b) which generates acid upon irradiation with an actinic ray or radiation; (b) a process of exposing the film; and (c) a process of forming a negative-type pattern by performing development using a developer including an organic solvent, an actinic ray-sensitive or radiation-sensitive resin composition used therefor, a resist film, a method of manufacturing an electronic device, and an electronic device.. . ... Fujifilm Corporation

04/23/15 / #20150110674

Coloration analysis device

In a coloration analysis device that analyzes a coloration state in a coloration region of a dry analysis element in which a coloration region is formed which reacts with a test substance in a specimen solution and is colored, the effects of irradiation intensity unevenness of measuring light or light-receiving position sensitivity unevenness of a light-receiving optical system are eliminated, and it is possible to perform accurate analysis. A coloration region of the dry analysis element 12 and reference measurement plates 110 and 111 are irradiated with measuring light by a photometric head 96, reflected light from a measurement object is two-dimensionally detected as an image, and correction processing is performed for each pixel of an image of the coloration region, using corresponding pixel information of images of a black reference measurement plate 110 and a white reference measurement plate 111.. ... Fujifilm Corporation

04/23/15 / #20150109691

Imaging lens and imaging device provided with the same

An imaging lens substantially consists of six lenses consisting of, in order from the object side: a first lens having a biconvex shape; a second lens having a negative refractive power; a third lens having a positive refractive power; a fourth lens having a positive refractive power; a fifth lens having a negative refractive power and having a concave surface toward the object side; and a sixth lens having a negative refractive power and having a concave surface toward the object side.. . ... Fujifilm Corporation

04/23/15 / #20150109690

Wide angle lens and imaging apparatus

A wide angle lens consists of a first lens group having negative refractive power as a whole, a second lens group having positive refractive power as a whole, and a third lens group having positive refractive power as a whole in this order from an object side. The first lens group consists of a positive meniscus lens with its convex surface facing the object side and three negative meniscus lenses, each with its convex surface facing the object side, in this order from the object side. ... Fujifilm Corporation

04/23/15 / #20150109685

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is substantially constituted by six lenses, including: a first lens having a positive refractive power and a convex surface toward the object side; a second lens, which is cemented to the first lens, having a negative refractive power and a concave surface toward the image side; a third lens; a fourth lens; a fifth lens; and a sixth lens. The imaging lens satisfies predetermined conditional formulae.. ... Fujifilm Corporation

04/23/15 / #20150109683

Lens system, lens barrel, and drive unit

An object is to provide a lens system that can change the magnitude of torque required to rotate an operation ring according to the attachment/detachment of a drive unit to/from a lens barrel, the lens barrel, and the drive unit. When the drive unit is not mounted on the lens barrel, a torque adjustment mechanism works and a friction member presses the operation ring by a biasing force of a biasing member. ... Fujifilm Corporation

04/23/15 / #20150109671

Zoom lens and imaging device

A zoom lens substantially consists of, in order from the object side, a positive first lens group, a negative second lens group, a positive third lens group, and a positive fourth lens group. During magnification change from the wide-angle end to the telephoto end, the first and the third lens groups are fixed in the optical axis direction, the second lens group is moved toward the image side, and the fourth lens group is moved along the optical axis. ... Fujifilm Corporation

04/23/15 / #20150109670

Zoom lens and imaging device

A zoom lens substantially consists of, in order from the object side, a positive first lens group, a negative second lens group, a positive third lens group, and a positive fourth lens group. During magnification change from the wide-angle end to the telephoto end, the first and third lens groups are fixed in the optical axis direction, the second lens group is moved toward the image side, and the fourth lens group is moved along the optical axis. ... Fujifilm Corporation

04/23/15 / #20150109510

Camera and method of controlling operation of same

It is arranged so that a user looking at an optical viewfinder and manipulating an operating member of a camera can ascertain which operating member is being manipulated. An optical image of a subject is displayed in the optical viewfinder. ... Fujifilm Corporation

04/23/15 / #20150109498

Imaging device, and image processing method

According to the present invention, the first and second phase difference pixels are arranged on the pixel lines in the first direction in the color image that is thinned during imaging of a moving image including that for live view display. Therefore, even during moving image taking, phase difference af can be accurately performed. ... Fujifilm Corporation

04/23/15 / #20150109497

Color imaging element and imaging device

The color imaging element and the imaging device according to the present invention can improve reproduction precision of demosaicing processing in a high frequency region and suppress aliasing. Further, the color imaging element can achieve high resolution by reducing occurrence of color moire (false color). ... Fujifilm Corporation

04/23/15 / #20150109495

Color imaging element and imaging device

A color filter array is configured with a 3×3 basic array pattern repeatedly disposed in a horizontal and a vertical direction. The basic array pattern is configured with a g filter array formed by disposing a g filter in the horizontal direction, and first and the second rgb filter arrays formed by disposing rgb filters in the horizontal direction. ... Fujifilm Corporation

04/23/15 / #20150109494

Color imaging element and imaging device

A color filter array of a color imaging element includes a basic array pattern p of 4×4 pixels in which rgb filters corresponding to red (r), green (g) and blue (b) are arrayed, this basic array pattern p is repeatedly disposed in a horizontal direction and a vertical direction, a g filter is disposed in each pixel line in four directions of horizontality, verticality, oblique upper right and oblique lower right, and r and b filters are disposed in each pixel line in the horizontal direction and vertical direction of the color filter array. Moreover, the color filter array includes consecutive first filters of two or more pixels in four directions of horizontality, verticality, oblique upper right and oblique lower right.. ... Fujifilm Corporation

04/23/15 / #20150109493

Color imaging element and imaging device

A color filter array of a color imaging element is formed with a basic array pattern repeatedly disposed in a horizontal direction and a vertical direction. The basic array pattern is formed with rgb filters arrayed in an array pattern corresponding to 5×5 pixels in the horizontal direction and the vertical direction. ... Fujifilm Corporation

04/23/15 / #20150109492

Color imaging element and imaging device

According to a color imaging element and an imaging device of the present invention, it is possible to simplify processing in a subsequent stage compared to the case of a random array, improve reproduction precision of de-mosaic processing in a high frequency range, facilitate de-mosaic processing as a result of increase in types of peripheral colors, discern a direction with high correlation between a horizontal direction and a vertical direction, and suppress aliasing upon de-mosaic processing.. . ... Fujifilm Corporation

04/23/15 / #20150109491

Color imaging element and imaging device

In the color imaging element, a basic array pattern is repeatedly placed in a first direction and in a second direction, the basic array pattern includes two sets of patterns each including a first pattern corresponding to 2×2 pixels composed of first filters, a second pattern corresponding to 1×2 pixels composed of the first filters, third patterns each corresponding to 2×2 pixels each composed of second filters, and fourth patterns each corresponding to 1×2 pixels each composed of the second filters, in a color filter array, first patterns and the third patterns are alternately disposed in the first direction, and the first patterns and the fourth patterns are alternately disposed in the second direction.. . ... Fujifilm Corporation

04/23/15 / #20150109467

Camera and method of controlling operation of same

It is arranged so that a camera user can recognize presence of camera shake in a case where the user is looking at a subject through an optical viewfinder. A portion of the image of a subject captured by a solid-state electronic image sensing device is displayed in an electronic viewfinder constituted by a liquid crystal display unit. ... Fujifilm Corporation

04/23/15 / #20150109420

Method and apparatus for three-dimensional measurement and image processing device

Three-dimensional measurement apparatus comprises first and second imaging units with baseline length, feature point detector for detecting feature points in image, corresponding point detector for detecting corresponding points corresponding to the feature points, rotation matrix calculator, translation matrix calculator, distance calculator, and data calculator. Based on the feature points and the corresponding points, the rotation matrix calculator calculates a rotation matrix representing direction and amount of rotation of a second image capture position relative to a first image capture position and the translation matrix calculator calculates a translation matrix representing a translation direction of the second image capture position relative to the first image capture position. ... Fujifilm Corporation

04/23/15 / #20150109360

Color conversion processing apparatus, color conversion processing method, and non-transitory storage medium

A color conversion processing apparatus calculates a hue angle of a spot color based on spot color information that defines the spot color, and then determines a spot color converting condition depending on the hue angle. The color conversion processing apparatus converts an original image signal of a spot color plate into an auxiliary-component image signal representing a color component of a process color plate according to the determined spot color converting condition.. ... Fujifilm Corporation

04/23/15 / #20150109252

Transparent laminate, capacitance type input device, and image display device

Provided is a transparent laminate which does not have a problem in which a transparent electrode pattern is visually recognized, a capacitance type input device having the transparent laminate, and an image display device provided with the capacitance type input device as a constituent element. The transparent laminate of the invention includes a region where a transparent substrate, a first transparent film having a refractive index of 1.6 to 1.78 and a film thickness of 55 nm to 110 nm, a transparent electrode pattern, and a second transparent film having a refractive index of 1.6 to 1.78 and a film thickness of 55 nm to 110 nm are laminated in this order in a plane.. ... Fujifilm Corporation

04/23/15 / #20150109231

Conductive film for touch panel and touch panel

In a conductive film for touch panel, a first electrode pattern is formed on the main surface at one side of an insulating layer, a second electrode pattern is formed on the main surface at the other side of the insulating layer, an adhesive insulating layer is disposed on at least one of the first electrode pattern and the second electrode pattern, an acid value of an adhesive insulating material contained in the adhesive insulating layer is equal to or greater than 10 mg koh/g and equal to or less than 100 mg koh/g, either or both of the first electrode pattern and the second electrode pattern contain silver, and a rate of change in mutual capacitance (%) between the first electrode pattern and the second electrode pattern before and after performing an environmental test is 0% to 100%.. . ... Fujifilm Corporation

04/23/15 / #20150108874

High frequency ultrasonic transducer and matching layer comprising cyanoacrylate

In one aspect, matching layers for an ultrasonic transducer stack having a matching layer comprising a matrix material loaded with a plurality of micron-sized and nano-sized particles. In another aspect, the matrix material is loaded with a plurality of heavy and light particles. ... Fujifilm Corporation

04/23/15 / #20150108086

Colored curable composition and color filter

A colored curable composition of the present invention contains a compound represented by general formula (1). In general formula (1), x1 to x4 each represents a halogen atom, and m represents a metal atom, a metal oxide, a metal halide or a non-metal. ... Fujifilm Corporation

04/16/15 / #20150105635

Skin evaluation method and skin evaluation device

. . A profile of optical reflectance relative to a depth within a depth range from an epidermis to an upper layer of a dermis is created based on a coherence signal obtained by optical coherence tomography, an evaluation index is determined by calculating a difference between reflectance at a local minimum point and reflectance at a second local maximum point from the created profile, and skin conditions are evaluated based on the evaluation index.. . ... Fujifilm Corporation

04/16/15 / #20150105481

Curable compositions and membranes

A process for preparing a membrane comprising applying a curable composition to a porous support and curing the composition, wherein the composition comprises: a) a curable ionic compound; b) a first crosslinking agent; c) a second crosslinking agent; d) an inert solvent; and e) optionally a free radical initiator; wherein the second crosslinking agent has a melting point below 80° c. Also claimed are the compositions and membranes obtainable by using the process.. ... Fujifilm Corporation

04/16/15 / #20150104746

Method of concentrating waste liquid produced by development, and method of recycling waste liquid produced by development

The invention provides a method of concentrating a waste liquid produced by development, the method including: obtaining a waste liquid produced by: exposing a planographic printing plate precursor, including: an image recording layer including: an infrared absorbing dye, a polymerization initiator, and a polymerizable compound, and a protective layer on a support, and performing a development process by using a developer liquid that contains an anionic surfactant having a naphthalene skeleton and/or a nonionic surfactant having a naphthalene skeleton in an amount of 1-10% by mass, that contains an organic solvent that has a boiling temperature in a range of 100-300° c. In an amount of 2% by mass or less, and that has a ph of 6.0-9.5; and evaporation-concentrating the waste liquid such that [an amount of the waste liquid after the concentration/an amount of the waste liquid before the concentration] is from 1/10 to 1/2 on a volume basis.. ... Fujifilm Corporation

04/16/15 / #20150103977

Method of producing thin film transistor, thin film transistor, display device, image sensor, and x-ray sensor

A method of producing a thin film transistor includes: forming a gate electrode; forming a gate insulating film that contacts the gate electrode; forming, by a liquid phase method, an oxide semiconductor layer arranged facing the gate electrode with the gate insulating film provided therebetween, the oxide semiconductor layer including a first region and a second region, the first region being represented by in(a)ga(b)zn(c)o(d), the second region being represented by in(e)ga(f)zn(g)o(h), and the second region being located farther from the gate electrode than the first region; and forming a source electrode and a drain electrode that are arranged apart from each other and are capable of being conductively connected through the oxide semiconductor layer.. . ... Fujifilm Corporation

04/16/15 / #20150103226

Optical lens, lens unit, imaging module, and electronic apparatus

An optical element includes an optical base material and a light blocking portion. The optical base material transmits light therethrough. ... Fujifilm Corporation

04/16/15 / #20150103217

Camera and method of controlling operation of same

It is arranged so that the user of a camera will not experience a sense of incongruity when the camera is switched between an optical viewfinder and an electronic viewfinder. When the electronic viewfinder function is set, the image of a subject captured by a solid-state electronic image sensing device is displayed on the display screen of a liquid crystal device and a viewfinder shutter closes. ... Fujifilm Corporation

04/16/15 / #20150103216

Image processing device and method and imaging apparatus

An image processing device according to the invention includes: a lens information acquisition unit; a color mixture information determination unit; mosaic image acquisition unit that, when the color mixture information determination unit determines that the color mixture information is unidentified, reads, from the color imaging element, a second mosaic image obtained by reducing the number of types of first pixels in the first mosaic image which includes a pixel of a first color formed by at least one color and a pixel of a second color formed by at least one color and in which the number of types of first pixels determined by the arrangement of pixels that are adjacent to a first pixel, which is the pixel of the first color, at a minimum pixel pitch in four directions is equal to or greater than 4; a color mixture correction unit; and a synchronization unit.. . ... Fujifilm Corporation

04/16/15 / #20150103210

Image processing device, imaging device, computer readable medium and image processing method

An image processing device includes a generation unit that generates a first display image on the basis of image signals from an imaging element that includes first and second pixel groups at which a subject image is pupil-divided and formed, and a second display image to be used for focus confirmation; a parallax calculation unit that calculates a parallax between pixels of a first image and pixels of a second image; a display unit that displays images; and a display control unit, wherein the generation unit generates the second display image by arranging the first divided image, which is a first image part, and the second divided image, which is the second image excluding regions corresponding to the first divided image, to be shifted by amounts corresponding to the parallax in opposing directions in an intersectional direction intersecting a division direction.. . ... Fujifilm Corporation

04/16/15 / #20150103185

Device for tracking adjustment and tracking adjustment method

A device for tracking adjustment comprising a zoom instruction input device, a focus instruction input device, a tracking instruction input device, an image signal obtaining device, a determining device which determines whether a state is a first adjustment state in which the zoom lens is set by the zoom instruction input device at a position on a tele side and the focus lens is moved by the focus instruction input device or a second adjustment state in which the zoom lens is set by the zoom instruction input device at a position on a wide side and the tracking lens is moved by the tracking instruction input device, an area setting device, an evaluation value generating device, and a display device, wherein the determining device determines whether the state is the first adjustment state or the second adjustment state based on the image signal obtained from the camera device.. . ... Fujifilm Corporation

04/16/15 / #20150103148

Method and apparatus for three-dimensional measurement and image processing device

A three-dimensional measurement apparatus comprises first and second imaging units, with a baseline length, a feature point detector, a corresponding point detector, a rotation matrix calculator, a translation matrix calculator, an epipolar line calculator, an evaluator, and a data calculator. The rotation matrix calculator and the translation matrix calculator calculate matrices representing directions of rotation and translation between the imaging positions a and b. ... Fujifilm Corporation

04/16/15 / #20150101246

Illumination apparatus used for plant cultivation

The present invention provides an illumination apparatus for plant cultivation, including a unit configured to change light in any wavelength region of 300 nm or higher and 600 nm or lower (wavelengths of 452 nm to 474 nm, for example) to light in the wavelength region having dominantly a right-circularly polarized light component. The illumination apparatus of the present invention enables irradiation with light that is capable of giving a specific effect in plant cultivation.. ... Fujifilm Corporation

04/09/15 / #20150099932

Light source apparatus and endoscope system

. . A fluorescent type of green light source of a semiconductor in a light source apparatus for an endoscope includes a blue excitation light source device and green emitting phosphor. The blue excitation light source device emits blue excitation light. ... Fujifilm Corporation

04/09/15 / #20150099192

Non-aqueous liquid electrolyte for secondary battery and non-aqueous liquid electrolyte secondary battery

A non-aqueous liquid electrolyte for a secondary battery, containing, in an aprotic solvent: an electrolyte; a particular nitrile compound; and a flame retardant composed of a particular phosphate compound or a phosphazene compound, in which the nitrile compound is contained in an amount of 0.1 parts by mass to 10 parts by mass with respect to 100 parts by mass of the flame retardant.. . ... Fujifilm Corporation

04/09/15 / #20150098499

Image processing apparatus, image pickup apparatus, computer, image processing method and computer readable non-transitory medium

An image processing apparatus that compresses image data according to a compression parameter, includes: a data acquisition section that acquires information on whether photographing condition data is added to the image data inputted or not and content of the photographing condition data; a compression parameter determination section that determines the compression parameter according to an acquisition result of the photographing condition data in the data acquisition section; and a compression processing section that applies compression processing to the image data according to the determined compression parameter, wherein the photographing condition data includes information related to presence or absence of an optical low-pass filter at time of photographing an image of the image data.. . ... Fujifilm Corporation

04/09/15 / #20150098099

Color conversion processing apparatus, color conversion processing method, and non-transitory storage medium

A color conversion processing apparatus acquires spot color information, which is capable of defining a spot color with device-dependent color values. The color conversion processing apparatus further acquires a reference profile and an updated profile, and using the spot color information, converts an image signal of a spot color plate into a first image signal of a process color plate. ... Fujifilm Corporation

04/09/15 / #20150098046

Polarizing plate protective film, polarizing plate, liquid crystal display device, and production method of polarizing plate protective film

There is provided a polarizing plate protective film having, on a substrate film, a layer formed by curing a curable composition containing, setting a total solid content of the curable composition to 100 mass %, from 50 to 99 mass % of the following (a) and from 1 to 30 mass % of the following (b) based on the total solid content: (a) at least either a compound having a cyclic aliphatic hydrocarbon group and an ethylenically unsaturated double bond or a compound having a fluorene ring and an ethylenically unsaturated double bond; and (b) a compound having, in the molecule, at least one of a benzene ring and a cyclohexane ring, and at least one of a hydroxyl group and a carboxy group and the (b) is defined as herein.. . ... Fujifilm Corporation

04/09/15 / #20150097127

Radiation image capture device, control method for erasing light source, and computer-readable storage medium

A radiation image capture device is provided that are capable of obtaining radiation images with better image quality than hitherto in both an imaging mode in which a radiation irradiation duration is comparatively short and radiation images are successively captured, and in an imaging mode in which the radiation irradiation duration is comparatively long. An erasing light source is deactivated throughout an imaging period in a first imaging mode in which a radiation detector generates image data of a radiation image based on radiation irradiated from a radiation source over a first irradiation duration. ... Fujifilm Corporation

04/02/15 / #20150095827

Person image decision apparatus for electronic album, method of controlling same, and recording medium storing control program therefor

. . . . A multiplicity of person images are classified into groups person by person. Representative thumbnail person images, which are representative of persons represented by person images included in respective ones of person image groups, are decided. ... Fujifilm Corporation

04/02/15 / #20150095825

Person image display control apparatus, method of controlling same, and recording medium storing control program therefor

A multiplicity of person images are classified into groups person by person. Representative thumbnail person images, which are representative of persons represented by person images included in respective ones of person image groups, are decided. ... Fujifilm Corporation

04/02/15 / #20150095772

Parameter setting assisting system, parameter setting assisting method, and non-transitory storage medium

A statistical process is performed on a plurality of differential data between a collection of finalized values of parameters, which have been set a plurality of times in the past (finalized value data), and a collection of initial values represented by a data template. In addition, a result image, which indicates the results of the statistical process, is generated. ... Fujifilm Corporation

04/02/15 / #20150094565

System and methods for enhanced imaging of objects within an image

Systems and methods which implement a plurality of different imaging signatures in generating an image frame are shown. A first imaging signature may be configured for providing relatively high quality images with respect to subsurface regions of living tissue, for example, whereas a second imaging signature may be configured for providing relatively high quality images with respect to interventional instruments inserted into living tissue at a steep angle. ... Fujifilm Corporation

04/02/15 / #20150094538

Endoscope system, processor device, and method for operating endoscope system

Violet light and blue light is applied sequentially to an object. In a wavelength range (380-440 nm) of the violet light, each of reflectances of most-superficial and superficial blood vessels is lower than reflectance of middle-layer blood vessels. ... Fujifilm Corporation

04/02/15 / #20150094537

Endoscope system and operating method thereof

A light source device simultaneously produces violet narrowband light and green narrowband light. A complementary color type imaging device of a complementary color type endoscope outputs first to fourth mixed pixel signals. ... Fujifilm Corporation

04/02/15 / #20150094534

Endoscope and method for manufacturing the same

The present invention aims to provide an endoscope and its manufacturing method enabling to reduce a diameter of the endoscope required to have airtightness and facilitate a connecting work between a cable and a connector. A first tube body and a second tube body constituting an airtight container are relatively moved to extend and contract, so that it is possible to extend cables from a proximal end part of the second tube body by contracting the container, thereby enabling a connecting work between the cables and an airtight connector. ... Fujifilm Corporation

04/02/15 / #20150094531

Electronic endoscopic device

An electronic endoscopic device includes a light source, an endoscopic scope including an imaging unit provided at a tip end, a temperature detecting unit that detects a temperature of the tip end, and a light source control unit that performs a light emission control and a light emission stop control in a frame period. The imaging unit includes a plurality of pixels and a driving unit, and the electronic endoscopic device further includes a control unit in which, when a temperature detected by the temperature detecting unit exceeds a threshold value, the control unit performs a control such that, in a frame period following a first frame period, a period in which the light emission stop control is performed is set to be longer, and a read-out speed of the imaging signal is set to be slower.. ... Fujifilm Corporation

04/02/15 / #20150094530

Light source apparatus, endoscope system and operating method

A light source apparatus for endoscopic imaging includes a light source for emitting at least narrow band blue light and narrow band green light, to illuminate an object in a body cavity. The light source is changeable over between field sequential lighting and simultaneous lighting. ... Fujifilm Corporation

04/02/15 / #20150093879

Temporary adhesive for production of semiconductor device, and adhesive support and production method of semiconductor device using the same

The invention is directed to a temporary adhesive for production of semiconductor device, containing (a) a polymer compound having an acid group, (b) a diluent, and (c) a solvent, an adhesive support including a substrate and an adhesive layer formed from the temporary adhesive for production of semiconductor device, and a production method of semiconductor device having a member processed including: adhering a first surface of a member to be processed to a substrate through an adhesive layer formed from the temporary adhesive for production of semiconductor device as claimed; conducting a mechanical or chemical processing on a second surface which is different from the first surface of the member to be processed to obtain the member processed; and releasing the first surface of the member processed from the adhesive layer.. . ... Fujifilm Corporation

04/02/15 / #20150093827

Cell culture carrier and cell culture vessel

A cell culture carrier comprises an anodic oxide film having a plurality of micropores penetrating in a thickness direction from a front surface to a rear surface, wherein an average opening diameter a of a front surface-side opening portion of the plurality of micropores and an average opening diameter b of a rear surface-side opening portion thereof have different values from each other, and the plurality of micropores has a shape in which an average diameter increases or decreases toward the rear surface-side opening portion from the front surface-side opening portion.. . ... Fujifilm Corporation

04/02/15 / #20150093826

Cell culture carrier and cell culture vessel

A cell culture carrier comprises an anodic oxide film having a plurality of micropores penetrating the anodic oxide film in a thickness direction, wherein an average density of the plurality of micropores is from 1 micropore/μm2 to 15,000 micropores/μm2, and an average opening ratio of the anodic oxide film is equal to or higher than 51%.. . ... Fujifilm Corporation

04/02/15 / #20150093692

Pattern forming method, actinic ray-sensitive or radiation-sensitive resin composition and resist film used therefor, and electronic device manufacturing method and electronic device using the samedevice manufacturing method and electronic device using the same

There is provided a pattern forming method including: (a) forming a film by an actinic ray-sensitive or radiation-sensitive resin composition containing (a) to (c), (a) a resin capable of increasing polarity by the action of an acid to decrease solubility in a developer containing an organic solvent, (b) a compound capable of generating acid upon irradiation with an actinic ray or radiation, and (c) a salt having a conjugate base structure of an acid having a pka of −2 or more in a molecule thereof and substantially not capable of decomposing by an actinic ray or radiation, (b) exposing the film, and (c) developing the exposed film using a developer containing an organic solvent to form a negative pattern.. . ... Fujifilm Corporation

04/02/15 / #20150093691

Actinic-ray- or radiation-sensitive resin composition and method of forming pattern using the composition

According to one embodiment, an actinic-ray- or radiation-sensitive resin composition includes compound (a) that when exposed to actinic rays or radiation, generates acids and resin (b) that when acted on by an acid, is decomposed to thereby increase its solubility in an alkali developer. Compound (a) is expressed by general formula (i) below. ... Fujifilm Corporation

04/02/15 / #20150093600

Ferromagnetic hexagonal ferrite powder, method of manufacturing the same, and magnetic recording medium

An aspect of the present invention relates to ferromagnetic hexagonal ferrite powder, the average particle size of which is equal to or less than 20 nm, and which comprises, on a particle number basis, equal to or more than 50% of ellipsoid hexagonal ferrite powders satisfying relation (1): 1.2<major axis length/minor axis length<2.0 . . ... Fujifilm Corporation

04/02/15 / #20150093034

Image allocation device and image allocation method

An image allocation device and an image allocation method are provided which are capable of calculating image characteristic quantities of a plurality of image data corresponding to a plurality of images, classifying the plurality of image data into image groups, whose number corresponds with the number of pages of display pages, based on the image characteristic quantities, and changing the sequence of the image groups according to the distances between the image groups as determined by the image characteristic quantities.. . ... Fujifilm Corporation

04/02/15 / #20150093027

Image processing apparatus and image processing method

An image processing apparatus for processing image data formed by a set of pixel data includes a real space filter processing unit and a color space filter processing unit, wherein the real space filter processing unit calculates a real space weighting coefficient and performs weighted average of pixel data according to filter processing of an edge preservation type; pixel data of at least a target pixel of pixel data used in the color space filter processing unit is pixel data calculated by the real space filter processing unit; and of the pixel data which the color space filter processing unit uses for the weighted average, the pixel data of the target pixel is pixel data calculated by the real space filter processing unit, and the pixel data of a peripheral pixel is pixel data forming the image data before being input to the real space filter processing unit.. . ... Fujifilm Corporation

04/02/15 / #20150093013

Radiation image processing apparatus and method

A composition information obtaining unit calculates a mammary gland/fat ratio and a first information obtaining unit obtains imaged contrast information representing a contrast of the radiation image. A second information obtaining unit sets target application condition of x-ray, and obtains target contrast information representing an intended contrast for the radiation image based on the intended application condition. ... Fujifilm Corporation

04/02/15 / #20150092997

Person recognition apparatus, person recognition method, and non-transitory computer readable recording medium

There are provided a person recognition apparatus, method, and a non-transitory computer readable recording medium which can perform accurate person recognition according to a time dependent face change. A sorting section sorts a plurality of images by shooting date and time. ... Fujifilm Corporation

04/02/15 / #20150092281

Zoom lens and imaging apparatus

The zoom lens substantially consists of a positive first lens group which is fixed while changing magnification, a negative second lens group which moves while changing magnification, a positive third lens group which moves while changing magnification, and a positive fourth lens group which is fixed while changing magnification in this order from the object side. The image formation magnification rates of the second lens group and the third lens group simultaneously pass a −1× point while changing magnification from the wide angle to the telephoto. ... Fujifilm Corporation

04/02/15 / #20150092280

Zoom lens and imaging apparatus

The zoom lens substantially consists of a positive first lens group fixed while changing magnification, a negative second lens group which moves from the object side to the image side while changing magnification, a positive third lens group which moves while changing magnification, and a positive fourth lens group which moves from the image side to the object side while changing magnification, and a positive fifth lens group fixed while changing magnification in this order from the object side. A floating system in which the third lens group and the fourth lens group move relative to each other while changing magnification is adopted. ... Fujifilm Corporation

04/02/15 / #20150092205

Image processing apparatus, image processing method, and recording medium

In the image processing apparatus, a color gamut information storage unit stores terminal information, color gamut determination information and color gamut information in association with one another; an input image determination unit determines whether the input image is a standard color gamut image or a non-standard color gamut image based on the color gamut determination information acquired based on the terminal information; and a first color conversion unit converts the input image as determined to be the non-standard color gamut image into an output image suitable for a color gamut of a printing apparatus based on the color gamut information acquired based on the terminal information so that the input image printed by the printing apparatus may be equal in color to the input image displayed on the display unit of the terminal device.. . ... Fujifilm Corporation

04/02/15 / #20150092123

Transfer film, manufacturing method of capacitive input device, capacitive input device, and image display device including the same

The transfer film of the present invention has a temporary support and a colored layer, and the colored layer contains at least (a) a white inorganic pigment and (b) a silicone-based resin.. . ... Fujifilm Corporation

04/02/15 / #20150092093

Imaging device and imaging method

A unit group which is formed by pixel cell rows l1, l2, l1a, and l2a is divided into groups bg1 and bg2. The defocus amount calculating unit calculates a phase difference of the output signal group of the phase difference detecting pixel cells 51r with respect to the output signal group of the phase difference detecting pixel cells 51l for bg1, calculates a phase difference of the output signal group of the phase difference detecting pixel cells 51l with respect to the output signal group of the phase difference detecting pixel cells 51r for bg2, and calculates a defocus amount based on a difference between the two calculated phase differences. ... Fujifilm Corporation

04/02/15 / #20150092092

Imaging element and imaging device

An imaging element having a plurality of pixel cells which is arranged in a row direction and a column direction which is perpendicular to the row direction in a lattice, in which two adjacent pixel cells which include photoelectric convening units which detect the same color light form a pair and the pairs are periodically arranged, in each of pixel cell rows in which pixel cells are arranged in the row direction, the micro lenses are arranged such that the micro lenses in odd-numbered pixel cell rows is off-centered in the row direction from the micro lenses in even-numbered pixel cell rows by a half of an arrangement pitch of the micro lenses, and each micro lens which is provided in at least one of the odd-numbered row and the even-numbered row is disposed over two photoelectric converting units which detect different color light.. . ... Fujifilm Corporation

04/02/15 / #20150092090

Image processing apparatus, image processing system, and image processing method

An image processing apparatus includes a reference image signal outputting unit that outputs a reference image signal in which color information of a plurality of colors is included in a chart image in a display plane or a time axis, a color display information detection unit that detects color display information of an image displayed on a displaying unit based on the reference image signal, a profile generation unit that generates a display characteristic profile of the displaying unit using the detected color display information and the color information of the chart image, a display characteristic correcting unit that generates a color correction image signal obtained by correcting an image signal to be output which is input from a modality based on the display characteristic profile, and a standardization processing unit that converts the generated color correction image signal to a standardization image signal.. . ... Fujifilm Corporation

04/02/15 / #20150092070

Composite image creation assist apparatus, composite image creation assist method, and non-transitory computer readable recording medium

There are provided a composite image creation assist apparatus and a composite image creation assist method capable of easily assisting the creation of a composite image using not only an image group that a user himself or herself holds but also images that other users hold. An other user image group extraction section extracts image groups of other users belonging to the same group as a target user based on the registration information of an sns. ... Fujifilm Corporation

04/02/15 / #20150092036

Driving method of imaging element, imaging device, and endoscopic device

It is a method of driving a mos type imaging element in which pixels having sensitivities for different colors are arranged two-dimensionally, in which the imaging element has at least two types of read-out lines having different pixel arrangements to read out a charge signal of the pixels, and the method includes driving such that a read-out time interval of a charge signal of at least one type of read-out line among the read-out lines is longer than a read-out time interval of another type of read-out line and a charge accumulating period of each pixel of the one type of read-out line is longer than a charge accumulating period of each pixel of said another type of read-out line.. . ... Fujifilm Corporation

04/02/15 / #20150092034

Endoscope system and endoscope operating method

An endoscope system includes a light source apparatus for emitting narrow band light of green and violet in field sequential lighting, for endoscopic imaging. An image sensor has plural pixels arranged on an imaging surface, for imaging an object in a body cavity illuminated with the narrow band light, to output a pixel signal. ... Fujifilm Corporation

04/02/15 / #20150092033

Endoscope system and light source device

Violet narrowband light vn and green narrowband light gn produced by a light source device are supplied to a complementary color type endoscope, and simultaneously applied to an observation object. From a complementary color type imaging device, first mixed pixels and second mixed pixels, which sense both of the violet narrowband light vn and the green narrowband light gn, are read out. ... Fujifilm Corporation

04/02/15 / #20150092032

Endoscope system and light source device

Violet narrowband light vn and green narrowband light gn produced by a light source device are supplied to a complementary color type endoscope, and simultaneously applied to an observation object. In a complementary color type imaging device, first mixed pixels and second mixed pixels, which sense both of the violet narrowband light vn and the green narrowband light gn, are read out. ... Fujifilm Corporation

04/02/15 / #20150092024

Image capturing device and image capturing method

The quality of a planar image is improved while maintaining the parallax of a stereoscopic image. An image capturing device includes an imaging element that performs photoelectric conversion on respective light fluxes passing through different regions of a single pickup lens. ... Fujifilm Corporation

04/02/15 / #20150091973

Ink for inkjet recording, ink set, image forming method and maintenance method

An ink for inkjet recording is provided, the ink including water, a coated carbon black that includes a carbon black pigment having a tea adsorption capacity of 0.5 meq/g or more and a resin that coats the carbon black, resin particles, and a water-soluble organic solvent having an sp value of less than 28 at a content of 2% by mass or more with respect to the total mass of the ink for inkjet recording, wherein a product of a glass transition temperature of the resin particles and the tea adsorption capacity of the carbon black pigment is 40° c.·meq/g or more. An ink set, an image forming method, and a maintenance method are also provided.. ... Fujifilm Corporation

04/02/15 / #20150091447

Calibration method and endoscope system

Light from each led is applied to an integrating sphere (reference object), and a light amount calculator calculates light reflected from the integrating sphere. Calibration data, in which source control signals applied to the leds are associated with amounts of the light from the leds emitted in response to the source control signals, respectively, is generated. ... Fujifilm Corporation

04/02/15 / #20150091217

Molding process, molded printed material, process for producing in-mold molded article, in-mold molded article, and decorative sheet

A molding process that comprises, in order, a preparation step of preparing a sheet having a textured pattern due to projections formed by curing an ink composition above one face of a substrate, a placement step of placing the face of the sheet having the textured pattern so that it faces a mold, and a molding step of carrying out molding with the sheet and the mold in contact with each other.. . ... Fujifilm Corporation

04/02/15 / #20150090910

Radiographic image reading device, computer readable medium, and radiographic image reading method

A radiographic image reading device includes a reading unit configured to photoelectrically read photostimulated luminescence light produced from a storage phosphor sheet illuminated with excitation light, the storage phosphor sheet, at which a radiographic image is stored, being scanned by a scanning unit using the excitation light; and a control unit configured to control the reading unit so as to cause the reading unit, in a case of reading at a first resolution, to read with excitation light at a first scanning speed and a first intensity and, in a case of reading at a second resolution that is a higher resolution than the first resolution, to read with excitation light at a second scanning speed that is slower than the first scanning speed and a second intensity that is smaller than the first intensity.. . ... Fujifilm Corporation

04/02/15 / #20150090397

Flexographic printing plate precursor for laser engraving, process for producing same and process for making flexographic printing plate

Disclosed is a process for producing a flexographic printing plate precursor for laser engraving, comprising, in order, steps of: forming a curable resin composition layer, which comprises (component a) an ethylenically unsaturated compound, (component b) a polymerization initiator, and (component c) a binder, on a temporary support; forming a resin layer, which has an oxygen transmission coefficient of equal to or lower than 15 cm3·cm/m2·day·atm and a shore a hardness of 20° to 70°, on the curable resin composition layer; and curing the curable resin composition layer.. . ... Fujifilm Corporation

03/26/15 / #20150087978

Complex diagnostic apparatus, complex diagnostic system, ultrasound diagnostic apparatus, x-ray diagnostic apparatus and complex diagnostic image-generating method

An optimal value calculator calculates, based on angle information obtained from a first angle sensor provided in an ultrasound probe, the direction of transmission of an ultrasonic beam transmitted from the ultrasound probe, and the radiation source optimal angle of a radiation source at which the direction of radiation from the radiation source is substantially parallel to the calculated direction of transmission of the ultrasonic beam and the optimal detection angle of a radiographic image generator at which the normal of a detection surface of the radiographic image generator is substantially parallel to the calculated direction of transmission of the ultrasonic beam.. . ... Fujifilm Corporation

03/26/15 / #20150087954

Medical image processing apparatus, method of operating the medical image processing apparatus, and medical image processing program

An organ region extracting section that extracts at least one organ region from a three dimensional image of a subject; a directional data obtaining section that obtains directional data of the subject based on one of the position of the organ region within the body of the subject and the shape of the organ region; a stage region extracting section that extracts a region of a stage on which the subject is placed from the three dimensional image; and a posture data obtaining section that obtains posture data of the subject on the stage, based on the region of the stage and the directional data of the subject; are provided.. . ... Fujifilm Corporation

03/26/15 / #20150087905

Endoscope having flexible tube

In an endoscope, a flexible device of an elongated tube has a variable stiffness device. The variable stiffness device includes a movable control wire and a coil spring, to which compression force is applied to change stiffness. ... Fujifilm Corporation

03/26/15 / #20150087903

Endoscope system and operating method thereof

A v-led, b-led, g-led and r-led for an endoscope are all driven to apply normal light to an object of interest in a body. An image sensor images the illuminated object and outputs an rgb image signal. ... Fujifilm Corporation

03/26/15 / #20150087156

Etching method, and method of producing semiconductor substrate product and semiconductor device using the same, as well as kit for preparation of etching liquid

A method of etching a semiconductor substrate, having the steps of: preparing an etching liquid by mixing a first liquid with a second liquid to be in the range of ph from 8.5 to 14, the first liquid containing a basic compound, the second liquid containing an oxidizing agent; and then applying the etching liquid to a semiconductor substrate on a timely basis for etching a ti-containing layer in or on the semiconductor substrate.. . ... Fujifilm Corporation

03/26/15 / #20150086912

Actinic ray-sensitive or radiation-sensitive resin composition, resist film and pattern forming method using the same, manufacturing method of semiconductor device, and semiconductor device

There is provided an actinic ray-sensitive or radiation-sensitive resin composition comprising (p) a resin having a repeating unit (a) represented by the specific formula (i) capable of generating an acid on the side chain of the resin upon irradiation with an actinic ray or radiation, and a resist film formed with the actinic ray-sensitive or radiation-sensitive resin composition, and a pattern forming method comprising: exposing the resist film, and developing the exposed resist film, and a method for manufacturing a semiconductor device, containing the pattern forming method, and a semiconductor device manufactured by the manufacturing method of the semiconductor device.. . ... Fujifilm Corporation

03/26/15 / #20150086911

Actinic ray-sensitive or radiation-sensitive resin composition, actinic ray-sensitive or radiation-sensitive film, mask blanks including actinic ray-sensitive or radiation-sensitive film, pattern forming method and photomask

An actinic ray-sensitive or radiation-sensitive resin composition includes; a compound (a) which generates an acid by irradiation with actinic rays or radiation, wherein the acid is linked with a group represented by the following general formula (m) through covalent bonding. In the formula, y1 and y2 each independently represent a hydrogen atom, an alkyl group, a cycloalkyl group, an alkenyl group, an alkynyl group, an aryl group, or an acyl group. ... Fujifilm Corporation

03/26/15 / #20150086801

Method for manufacturing complex for carbon dioxide separation, complex for carbon dioxide separation, and module for carbon dioxide separation

A method for manufacturing a complex for carbon dioxide separation, the complex for carbon dioxide separation including a support and a carbon dioxide separation layer on the support, and the method including: applying, on the support, a coating liquid for forming the carbon dioxide separation layer including: a water-absorbing polymer, an alkali metal salt, and a filler having a density lower than a density of the alkali metal salt, a new mohs hardness of 2 or greater, and a volume average particle diameter that is 30% or less of a thickness of the carbon dioxide separation layer; and drying the coating liquid applied for forming the carbon dioxide separation layer to obtain the carbon dioxide separation layer.. . ... Fujifilm Corporation

03/26/15 / #20150086120

Image processing apparatus, image processing method and recording medium

In an image processing apparatus, an image acquiring section acquires one or more images. An image analysis information acquiring section acquires image analysis information on each of the one or more images. ... Fujifilm Corporation

03/26/15 / #20150086116

Image processing apparatus, image processing method and recording medium

In an image processing apparatus, an image acquiring section acquires a group of candidate images for use in creating a recommended composite image to be proposed to a user; an image analysis information acquiring section acquires image analysis information on each image of the group of candidate images; a theme determining section determines a theme of the group of candidate images based on the image analysis information on each image of the group of candidate images; a template selecting section selects a template for use in creating a recommended composite image based on the theme of the group of candidate images; and a layout section creates a recommended composite image in which images of the group of candidate images are laid out in the template.. . ... Fujifilm Corporation

03/26/15 / #20150086111

Image processing method, image processing apparatus, and image processing program

In the image processing apparatus, input transform into an input color space is performed on input image data; after the input transform, transform processing of transforming chroma or chromaticity of the input image data or chroma or chromaticity in the input color space is performed so as to reduce a difference between a space of chroma or chromaticity of the input image data and a space of chroma or chromaticity in the input color space to acquire transformed image data; and output transform into an output color space is performed on the transformed image data using a three-dimensional lookup table including inverse transform processing of returning the chroma or chromaticity of the transformed image data to the chroma or chromaticity of the input image data to acquire output image data.. . ... Fujifilm Corporation

03/26/15 / #20150085980

Radiological image-capturing device, radiological image-capturing system, radiological image-capturing method, and program

A radiological image-capturing device includes: a first read control section that executes a first read mode in which electric signals stored in a plurality of pixels are read out simultaneously in units of a plurality of rows; and an emission-start determining section that determines that the emission of radiation from a radiation source onto an image-capturing panel has started when the values of the electric signals read by the first read control section have become greater than an arbitrarily settable threshold. If it is determined by the emission-start determining section that the emission of the radiation has started, the first read control section terminates the reading of the electric signals, and thereby brings the image-capturing panel into an exposure state.. ... Fujifilm Corporation

03/26/15 / #20150085386

Imaging lens and imaging device provided with the same

An imaging lens substantially consists of five lenses consisting of, in order from the object side: a first lens having a positive refractive power and having a meniscus shape with the convex surface toward the object side; a second lens having a biconcave shape; a third lens having a positive refractive power and having a meniscus shape with the convex surface toward the image side; a fourth lens having a positive refractive power and having a convex surface toward the image side; and a fifth lens having a negative refractive power, wherein a predetermined conditional expression is satisfied.. . ... Fujifilm Corporation

03/26/15 / #20150085385

Imaging lens and imaging device provided with the same

An imaging lens substantially consists of five lenses consisting of, in order from the object side: a first lens having a positive refractive power and having a meniscus shape with a convex surface toward the object side; a second lens having a biconcave shape; a third lens having a positive refractive power and having a meniscus shape with a convex surface toward the image side; a fourth lens having a meniscus shape with a convex surface toward the image side; and a fifth lens having a negative refractive power and having a concave surface toward the object side.. . ... Fujifilm Corporation

03/26/15 / #20150085381

Imaging lens and imaging device provided with the same

An imaging lens substantially consists of five lenses consisting of, in order from the object side: a first lens having a positive refractive power and having a meniscus shape with the convex surface toward the object side; a second lens having a biconcave shape; a third lens having a negative refractive power and having a meniscus shape with the convex surface toward the image side; a fourth lens having a positive refractive power; and a fifth lens having a negative refractive power, wherein an image-side surface of the fifth lens includes a concave surface and at least one inflection point, wherein a predetermined conditional expression is satisfied.. . ... Fujifilm Corporation

03/26/15 / #20150085375

Variable magnification optical system for projection and projection-type display apparatus

A variable magnification optical system for projection consists of a negative lens group and a positive lens group in this order from a magnification side. A distance on an optical axis between the negative lens group and the positive lens group changes during magnification change, and an entire system substantially consists of six lenses. ... Fujifilm Corporation

03/26/15 / #20150085178

Image capturing apparatus and focusing control method

An image capturing apparatus, includes: an image capturing element configured to capture an image of a subject; and a focusing control unit configured to perform a focusing control by a phase difference af method using detection signals of first signal detection units and second signal detection units; a matching degree generation unit configured to generate a first matching degree which corresponds to a matching degree of two images captured by a first pair using the detection signals of the respective signal detection units of the first pair, and a second matching degree which corresponds to a matching degree of two images captured by a second pair using the detection signals of the respective signal detection units of the second pair; and a credibility determination unit configured to determine credibility of the focusing control by the phase difference af method based on the first matching degree and the second matching degree.. . ... Fujifilm Corporation

03/26/15 / #20150083924

Radiographic imaging device and radiation detector

First tfts are provided in correspondence with respective intersection portions between plural signal lines and plural first scan lines. Control terminals of the first tfts are connected to the corresponding first scan lines, and output terminals of the first tfts are connected to the corresponding signal lines. ... Fujifilm Corporation

03/19/15 / #20150081333

Medical care information display control apparatus, method, and medium with medical care information display control program recorded thereon

. . . . . . Identifying, using information of disease duration of each disease of a first patient, a non-overlapping period of disease duration of a target disease that does no overlap with disease durations of the other diseases, and extracting medical care data whose registration date and time is included in the non-overlapping period of the target disease from the medical care data of the first patient and generates a display item set composed of the medical care item corresponding to the extracted medical care data. Then, displaying, using information of medical care data of a second patient, medical care data corresponding to the medical care item of the generated display item set.. ... Fujifilm Corporation

03/19/15 / #20150080757

Gas supply apparatus

A gas supply apparatus includes: a gas supply conduit for supplying a gas to a digestive tract; a pressure detecting device which detects a pressure in the digestive tract; a flow regulating device which regulates a gas amount supplied from the gas supply source to the digestive tract via the gas supply conduit; a first control device which controls the flow regulating device according to a result detected by the pressure detecting device to supply the gas into the digestive tract so that the pressure inside the digestive tract becomes a set pressure; a second control device which controls the flow regulating device to supply a fixed gas amount into the digestive tract; and a gas supply mode switching device which switches between gas supply modes including a mode for executing control by the first control device and a mode for executing control by the second control device.. . ... Fujifilm Corporation

03/19/15 / #20150080734

Ultrasound image diagnostic apparatus

The present invention aims at providing an ultrasound image diagnostic apparatus capable of shortening the time required for measurement and calculation of an optimal sound velocity and obtaining an ultrasound image having excellent image quality at a tissue or lesion the operator desires to observe. There are provided an element data memory storing element data; a region-of-interest setter setting a region of interest; an optimal sound velocity calculator calculating an optimal sound velocity at the region of interest using the element data corresponding to the region of interest; a reconstruction region setter setting a reconstruction region that contains the region of interest and is larger than the region of interest; and an image reconstructor generating a reconstructed image by reconstructing the ultrasound image in the reconstruction region based on the optimal sound velocity.. ... Fujifilm Corporation

03/19/15 / #20150080733

Ultrasound diagnostic apparatus and ultrasound diagnostic image data processing method

In this ultrasound diagnostic device and ultrasound diagnostic image data processing method, an element data determination unit compares a pre-set threshold value with the average value of the amplitude values in the element direction of the element data calculated by an average value calculation unit in the element direction, and an rf data calculation unit performs a process in which the element data of which the absolute value of the amplitude value is the maximum is adopted as the rf data without phasing addition when the average value (aa) is greater than the threshold value. Meanwhile, when the average value (ab) is equal to or lower than the threshold value, the rf data calculation unit performs a process in which the average values of all the amplitude values in the element direction of the element data are adopted as the rf data without phasing addition.. ... Fujifilm Corporation

03/19/15 / #20150080732

Ultrasound diagnostic apparatus and data processing method

In the ultrasound diagnostic apparatus, the ultrasonic wave transmitter/receiver transmits an ultrasonic beam to a subject, receives an ultrasonic echo that is a reflected ultrasonic beam from the subject, and outputs reception data; and the ambient sound speed calculator acquires first reception data for calculating an ambient sound speed as a sound speed in the subject, which is data of a lower frequency than second reception data for producing a brightness image of the subject, and analyses the acquired first reception data to calculate the ambient sound speed.. . ... Fujifilm Corporation

03/19/15 / #20150080731

Ultrasound diagnostic apparatus and data processing method

In the ultrasound diagnostic apparatus, the ultrasonic wave transmitter/receiver transmits and receives an ultrasonic beam to a subject to generate reception data; the delay correction unit corrects a delay time of the reception data to align a phase of the reception data; the reception aperture level setting unit sets two or more reception aperture levels of reception data from reception data after correction of the delay time; the image producer produces ultrasound images corresponding to the set reception aperture levels, by performing phase matching addition on the reception data after correction of the delay time; and the image quality determination unit determines image qualities of the ultrasound images corresponding to the set reception aperture levels and selects an ultrasound image having a predetermined image quality.. . ... Fujifilm Corporation

03/19/15 / #20150080729

Ultrasound diagnostic apparatus and method of producing ultrasound image

An ultrasound diagnostic apparatus and a method of producing an ultrasound image capable of accurately determining the boundary of an intima-media complex in an ultrasound image and measuring an intima-media thickness with high precision are provided. A candidate vascular wall boundary point determiner determines one or more candidate vascular wall boundary points based on a sound ray signal extending in a scanning direction in an ultrasound image. ... Fujifilm Corporation

03/19/15 / #20150080662

Objective lens for an endoscope and endoscope

The objective lens for an endoscope substantially consists of a first lens group having a negative refractive power, a stop, and a second lens group having a positive refractive power in this order from the object side. The first lens group consists of a single negative lens. ... Fujifilm Corporation

03/19/15 / #20150080653

Endoscope system, processor device, and method for operating endoscope system

A subject irradiated with violet light and green light is imaged to obtain rgb signals, based on which a base image is produced. Frequency filtering processing is applied to the b signal to obtain a blood vessel extraction signal, in which a most superficial blood vessel, a superficial blood vessel, and a middle-layer blood vessel at different depths are extracted. ... Fujifilm Corporation

03/19/15 / #20150080650

Endoscopic surgery device and outer tube

An object of the present invention is to provide an endoscopic surgery device and an outer tube, capable of easily obtaining an image desired by an operator to facilitate treatment as well as of performing minimally invasive surgery. In the endoscopic surgery device and the outer tube, an endoscope and a treatment tool are inserted into a body cavity through an outer tube. ... Fujifilm Corporation

03/19/15 / #20150080582

Optical film, retardation plate, elliptica polarizing plate, liquid crystal display device and compound

An optical film including at least one compound represented by formula (1) is disclosed. In the formula, y11, y12 and y13 each independently represent methine or a nitrogen atom; r11, r12 and r13 each independently represent formula (a), (b) or (c) or a hydrogen atom, provided that at least two of r11, r12 and r13 each independently represent formula (a), (b) or (c). ... Fujifilm Corporation

03/19/15 / #20150079804

Under layer film-forming composition for imprints and method of forming pattern

An under layer film having excellent surface planarity is provided. In one aspect, the under layer film-forming composition for imprints includes a (meth)acrylic resin (a) containing an ethylenic unsaturated group (p) and a nonionic hydrophilic group (q), and having a weight average molecular weight of 1,000 or larger; and a solvent (b), the resin (a) having an acid value of smaller than 1.0 mmol/g. ... Fujifilm Corporation

03/19/15 / #20150079793

Adhesion-promoting composition used between curable composition for imprints and substrate, and semiconductor device using the same

Provided is an adhesion-promoting composition between a curable composition for imprints and a substrate, which excellent in adhesiveness and can control pattern failure. An adhesion-promoting composition used between a curable composition for imprints and a substrate, which comprises a compound having a molecular weight of 500 or larger and having a reactive group, and has a content of a compound, with a molecular weight of 200 or smaller, of more than 1% by mass and not more than 10% by mass of a total solid content.. ... Fujifilm Corporation

03/19/15 / #20150079522

Pattern forming method, resist composition for multiple development used in the pattern forming method, developer for negative development used in the pattern forming method, and rinsing solution for negative development used in the pattern forming method

A pattern forming method, including: (a) coating a substrate with a positive resist composition of which solubility in a positive developer increases and solubility in a negative developer decreases upon irradiation with actinic rays or radiation, so as to form a resist film; (b) exposing the resist film; and (d) developing the resist film with a negative developer; a positive resist composition for multiple development used in the method; a developer for use in the method; and a rinsing solution for negative development used in the method.. . ... Fujifilm Corporation

03/19/15 / #20150079508

Pattern forming method, actinic ray-sensitive or radiation-sensitive resin composition, resist film, manufacturing method of electronic device, and electronic device

There is provided a pattern forming method comprising (i) a step of forming a film by an actinic ray-sensitive or radiation-sensitive resin composition; (ii) a step of exposing the film; and (iii) a step of performing development by using a developer containing an organic solvent to form a negative pattern, wherein the actinic ray-sensitive or radiation-sensitive resin composition contains (a) a resin capable of increasing the polarity by an action of an acid to decrease the solubility in a developer containing an organic solvent, (b) a compound capable of generating an acid upon irradiation with an actinic ray or radiation, (c) a solvent, and (d) a resin having a repeating unit having a fluorine atom and not having a cf3 partial structure.. . ... Fujifilm Corporation

03/19/15 / #20150079380

Optically anisotropic layer, method of manufacturing the same, laminate, method of manufacturing the same, polarizing plate, liquid crystal display device, and organic el display device

To suppress a phenomenon where an optical axis of the optically anisotropic layer is tilted when the optically anisotropic layer is produced by using a liquid crystalline compound showing smectic phase as a materials showing a higher level of orderliness. An optically anisotropic layer wherein a polymerizable composition, containing one or more polymerizable rod-like liquid crystal compound showing a smectic phase, is fixed in a state of smectic phase, and a direction of maximum refractive index of the optically anisotropic layer is inclined at 10° or smaller to the surface of the optically anisotropic layer, a method for manufacturing the same, a laminate and a method for manufacturing the same, a polarizing plate, a liquid crystal display device, and an organic el display device.. ... Fujifilm Corporation

03/19/15 / #20150078529

Portable radiation imaging apparatus and portable radiation imaging system

A portable x-ray imaging apparatus has an electronic cassette and a console capable of receiving an imaging order. The console has a wireless communication section, a trigger signal obtaining section, a connection determining section, a switching section, and a delivery requesting section. ... Fujifilm Corporation

03/19/15 / #20150078528

Radiographic imaging apparatus, method and system

In an x-ray imaging apparatus, a detection panel has monitor pixels for monitoring x-rays. A signal processor samples a dose signal of a dose per unit time of x-rays according to an output of the monitor pixels. ... Fujifilm Corporation

03/19/15 / #20150078527

Portable radiographic imaging apparatus and system

A portable x-ray imaging apparatus includes an electronic cassette for imaging of an x-ray image and transmitting the x-ray image wirelessly. An image receiving unit communicates with the electronic cassette and receives the x-ray image wirelessly. ... Fujifilm Corporation

03/19/15 / #20150078522

Radiographic imaging system and access controller for communication access

An x-ray imaging system includes an x-ray imaging apparatus and an access controller, which controls communication access of the x-ray imaging apparatus having an electronic cassette for forming an x-ray image and wirelessly transmitting the x-ray image. Before the electronic cassette starts transmitting the x-ray image, a priority request signal for priority of the first radio communication channel to the electronic cassette over a portable terminal device of radio communication is received. ... Fujifilm Corporation

03/19/15 / #20150077866

Imaging lens and imaging apparatus including the imaging lens

An imaging lens substantially consists of, in order from an object side, five lenses of a first lens that has a biconvex shape, a second lens that has a negative refractive power, a third lens, a fourth lens that has a positive refractive power, and a fifth lens that has a negative refractive power and has an object side surface and an image side surface which have aspheric shapes. Further, the imaging lens satisfies predetermined conditional expressions.. ... Fujifilm Corporation

03/19/15 / #20150077865

Imaging lens and imaging apparatus including the imaging lens

An imaging lens substantially consists of, in order from an object side, five lenses of a first lens that has a biconvex shape, a second lens that has a negative refractive power, a third lens, a fourth lens that has a positive refractive power, and a fifth lens that has a negative refractive power and has an object side surface and an image side surface which have aspheric shapes. Further, the imaging lens satisfies predetermined conditional expressions.. ... Fujifilm Corporation

03/19/15 / #20150077864

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is substantially constituted by five lenses, including: a first lens having a positive refractive power; a second lens having a negative refractive power; a third lens having a negative refractive power; a fourth lens having a negative refractive power; a fifth lens having a negative refractive power and an inflection point on the surface thereof toward the image side. All of the first lens through the fifth lens are single lenses, and the imaging lens satisfies predetermined conditional formulae.. ... Fujifilm Corporation

03/19/15 / #20150077863

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens is constituted by: a first lens having a positive refractive power and is of a meniscus shape with a convex surface toward the object side; a second lens having a negative refractive power; a third lens having a positive refractive power and a convex surface toward the object side; a fourth lens having a positive refractive power and a convex surface toward the object side; and a fifth lens having a negative refractive power, a concave surface toward the image side on the surface thereof toward the image side in the vicinity of the optical axis, and an inflection point on the surface thereof toward the image side, provided in this order from the object side.. . ... Fujifilm Corporation

03/19/15 / #20150077800

Printing management device and method, printing management system, printing system and information processing device

A printing management device includes: a customer property db configured to accumulate history data for each customer; a printer property db configured to record printer property data for each of multiple printers; target image quality index decision means configured to decide a target image quality index by the use of the history data of the customer property db; and printout condition decision means configured to decide/output output conditions with reference to the printer property db according to order information and the target image quality index.. . ... Fujifilm Corporation

03/19/15 / #20150077597

Imaging device, image processing device, and image processing method

An imaging device includes a photography optical system, and a single plate-type imaging element in which a plurality of pixels including two-dimensionally arranged photoelectric conversion elements and having a different underlayer layout are repeatedly arranged in a predetermined pattern, and color filters on the plurality of pixels, determination unit determines that a ghost is generated when an output level of one of the plurality of pixels and an output level of the same color pixel in the vicinity of the one pixel, which is the other pixel having a different underlayer layout from the one pixel, are different within a range in which the output levels do not exceed a predetermined threshold, and correction unit reducing a difference of the output level between the one pixel and the same color pixel in the vicinity when the determination unit determines that the ghost is generated.. . ... Fujifilm Corporation

03/19/15 / #20150077376

Image display device, image display method and program

In the image display device, the touch operation detection unit detects the touch operation of the user input through the touch panel; the image selection unit selects images in the category corresponding to the tag information specified through the touch operation from among the images stored in the image storage unit based on the tag information; and the display control unit extracts main subject areas of the images in the category selected by the image selection unit based on the frame information, and displays the extracted main subject areas on the screen of the touch panel in a predetermined order according to an image display procedure corresponding to the tag information specified through the touch operation.. . ... Fujifilm Corporation

03/19/15 / #20150076358

Radiation imaging device, radiation imaging system, radiation imaging device control method, and recording medium storing radiation imaging device control program

Radiation images with different resolutions may be captured using a general-purpose driver configured with a shift register group in a single system. Each shift register is connected to a first gate line or a second gate line via a connection terminal in accordance with wiring of a radiation detector. ... Fujifilm Corporation

03/19/15 / #20150075399

Resin composition for laser engraving, process for producing relief printing plate precursor for laser engraving, relief printing plate precursor, process for making relief printing plate, and relief printing plate

A relief printing plate precursor for laser engraving is provided. The precursor has high ink resistance toward both an aqueous ink and a solvent ink and is excellent in terms of engraving sensitivity. ... Fujifilm Corporation

03/19/15 / #20150075069

System for selective irradiation with circularly polarized light

According to the present invention, provided is a system for irradiating a target object selectively with specific circularly polarized light, comprising a polarization-state control member that controls the polarization state of light to thereby generate circularly polarized light; and a circularly polarized light-reflecting member, wherein the circularly polarized light-reflecting member is disposed at a position on which the circularly polarized light emitted from the polarization-state control member can be incident; the circularly polarized light-reflecting member generates reflected light that selectively comprises circularly polarized light of the same sense as the incident circularly polarized light from the polarization-state control member; and the circularly polarized light-reflecting member is disposed such that the target object can be irradiated with at least a part of the reflected light.. . ... Fujifilm Corporation

03/12/15 / #20150073214

Endoscope system having connector

An endoscope system includes an endoscope and a cleaning adapter or connector. The endoscope has a port device or end sleeve, to which the cleaning adapter is coupled. ... Fujifilm Corporation

03/12/15 / #20150072525

Polishing liquid and polishing method

A method for chemical mechanical polishing of a body to be polished in a planarization process for manufacturing of a semiconductor integrated circuit. The body to be polished including at least a first layer containing polysilicon or modified polysilicon and a second layer containing at least one selected from the group consisting of silicon oxide, silicon nitride, silicon carbide, silicon carbonitride, silicon oxycarbide, and silicon oxynitride. ... Fujifilm Corporation

03/12/15 / #20150072274

Chemical amplification resist composition, resist film using the same, resist-coated mask blank, method of forming photomask and pattern, and method of manufacturing electronic device and electronic device

A chemical amplification resist composition according to the present invention includes (a) a compound including a triarylsulfonium cation having one or more fluorine atoms and capable of generating an acid with a volume of 240 Å3 or higher by irradiation of active rays or radiation; and (b) a compound including a phenolic hydroxyl group.. . ... Fujifilm Corporation

03/12/15 / #20150072246

Non-aqueous liquid electrolyte for secondary battery and non-aqueous secondary battery

A non-aqueous liquid electrolyte for a secondary battery, the non-aqueous liquid electrolyte containing an electrolyte, an organic typical metal compound and an organic solvent, the organic solvent containing the electrolyte and the organic typical metal compound, the organic typical metal compound being contained in the organic solvent in an amount of 1 mol/l or less.. . ... Fujifilm Corporation

03/12/15 / #20150072225

Non-aqueous secondary battery and non-aqueous liquid electrolyte for secondary battery

A non-aqueous secondary battery containing: a positive electrode containing a transition metal oxide as an active material thereof; a negative electrode; and a non-aqueous liquid electrolyte containing an electrolyte, an organic solvent, and less than 0.1 mol/l of an organometallic compound containing a transition element or a rare-earth element as a central metal thereof.. . ... Fujifilm Corporation

03/12/15 / #20150071553

Image processing device, method and program

An image processing device includes a candidate point extracting unit configured to extract a plurality of candidate points belonging to a predetermined structure from image data, a shape model storing unit configured to store a shape model representing a known shape of the predetermined structure, the shape model being formed by a plurality of model labels having a predetermined connection relationship, and a corresponding point selecting unit configured to select a mapping relationship between the candidate points and the model labels from a set of candidate mapping relationships.. . ... Fujifilm Corporation

03/12/15 / #20150071414

Radiographic imaging system and system operation method

An x-ray imaging system includes a plurality of electronic cassettes having fpds. One of the plural electronic cassettes for use in imaging is selected by input operation. ... Fujifilm Corporation

03/12/15 / #20150071403

Radiographic system and radiographic image generating method

In a radiographic system and a radiographic image generating method that generate a phase contrast image and an absorption image of an subject, the absorption image in which density irregularity is removed or reduced is generated on the basis of a plurality of pieces of image data obtained for generating the phase contrast image.. . ... Fujifilm Corporation

03/12/15 / #20150071031

System and method for performing progressive beamforming

A progressive beamformer in an imaging system includes a number of stages. A first stage delays and combines a number of received data streams to align the streams to a point of interest on a first beamline. ... Fujifilm Corporation

03/12/15 / #20150070935

Light guide plate

A large-sized thin light guide plate has a first layer on a light exit surface side and a second layer on a rear surface side containing scattering particles at a higher particle concentration than the first layer. Thicknesses of the layers in a direction substantially perpendicular to the light exit surface change to change a combined particle concentration. ... Fujifilm Corporation

03/12/15 / #20150070787

Imaging lens and imaging device provided with the same

An imaging lens substantially consists of five lenses consisting of, in order from the object side: a first lens having a positive refractive power with a convex surface toward the object side; a second lens having a negative refractive power and having a meniscus shape with a convex surface toward the image side; a third lens having a positive refractive power and having a meniscus shape with a convex surface toward the image side; a fourth lens having a positive refractive power and having a meniscus shape with a convex surface toward the image side; and a fifth lens having a negative refractive power, wherein an image-side surface of the fifth lens includes a concave surface and at least one inflection point, wherein a predetermined conditional expression is satisfied.. . ... Fujifilm Corporation

03/12/15 / #20150070778

Variable magnification projection optical system and projection display apparatus

A variable magnification projection optical system substantially consisting of two lens groups of a first lens group having a positive refractive power and is moved during magnification change, and a second lens group having a positive refractive power and is moved during magnification change, in which the variable magnification projection optical system is configured such that the reduction side is telecentric.. . ... Fujifilm Corporation

03/12/15 / #20150070717

Color reproduction assisting system, color reproduction assisting method, and non-transitory storage medium

A plurality of printing conditions and designated color information are acquired, and it is judged whether a designated color specified from the designated color information can be reproduced under the printing conditions or not. On condition that at least one of the printing conditions under which the designated color cannot be reproduced is judged as being present, then a substitute color that is different from the designated color is determined in order to increase the number of the printing conditions under which the designated color can be reproduced. ... Fujifilm Corporation

03/12/15 / #20150070551

Imaging device

An imaging device comprising an imaging optical system, a lens movement mechanism, an imaging element, a first interpolation device, a second interpolation devices, a photographic image generation device, a split image generation device using a first image formed by the outputs of the first phase difference pixels and the first interpolation pixels and a second image formed by the outputs of the second phase difference pixels and the second interpolation pixels to generate a split image, and a display device displaying the photographic image generated by the photographic image generation device, the display device displaying the split image generated by the split image generation device in a display area of the photographic image.. . ... Fujifilm Corporation

03/12/15 / #20150070539

Image capture device and image display method

An image capture element includes phase difference pixel groups (first and second pixel groups) corresponding to first and second images with a phase difference according to a focus shift, includes a third pixel group corresponding to a normal third image, outputs a first image and a second image with bayer arrays from the first and second pixel groups, and outputs a third image with the same color array as a raw image from the third pixel group. A color split image is generated based on the first and second images acquired from the image capture element, a color image for display is generated based on the third image, and the color split image is synthesized with part of the generated color image for display to thereby display a live-view image in which the split image is synthesized.. ... Fujifilm Corporation

03/12/15 / #20150070529

Imaging apparatus and image correction data generating method

It is an imaging apparatus that outputs subject capture images having a plurality of kinds of number of pixels by binning imaging in which pixel addition of a plurality of pixels of an imaging device is performed, including: a correction information storage unit that stores a dark correction file storing an image correction data for one screen of the imaging device, a correction calculation data generating unit that generates a correction calculation data by obtaining a correction calculation value corresponding to each pixel of the subject capture image from the image correction data when the number of pixels of the subject capture image is different from the number of pixels of the image correction data; and an image correcting unit that corrects each pixel of the subject capture image by using the correction calculation value of a corresponding pixel position of the correction calculation data.. . ... Fujifilm Corporation

03/12/15 / #20150070519

Image sensing apparatus and method of controlling operation of same

Image stabilization, which shifts the center of an image sensing device radially away from the optical axis of an imaging lens is performed multiple times in one frame. A path in a case where the movement of the center of the image sensing device at this time is viewed from the front is generated. ... Fujifilm Corporation

03/12/15 / #20150069934

Regenerative drive for piezoelectric transducers

A method for regenerative driving of one or more transducers includes, for each of a plurality of driving cycles, enabling a number of transducers for driving, configuring a configurable capacitive energy storage element based on the number of enabled transducers and a desired overall capacitance, transferring a predetermined quantity of energy from a power supply to a first inductive energy transfer element, distributing the predetermined quantity of energy from the first inductive energy transfer element to the configurable capacitive energy storage element and to one or more other capacitive energy storage elements, each of the other capacitive energy storage elements coupled to an associated transducer, transferring energy from the one or more capacitive energy storage elements and from the configurable capacitive energy storage element to a second inductive energy transfer element, and transferring energy from the second inductive energy transfer element to the power supply.. . ... Fujifilm Corporation

03/12/15 / #20150068884

Conductive sheet and conductive sheet for touch panel

A conductive sheet, method for using conductive sheet and touch panel, having a base substance and conductive parts formed on one of the principal surfaces of the base substance. The conductive parts respectively extend in primary directions, and have two or more conductive patterns made from metal wires arranged in a second direction that is perpendicular to the first direction. ... Fujifilm Corporation

03/12/15 / #20150068602

Cyclic carbodiimide compound, polyester film, back sheet for solar cell module, and solar cell module

A polyester film including a cyclic carbodiimide compound represented by the following formula (o-1) has good film thickness uniformity without increase in viscosity. R1 and r5 represent an alkyl group, an aryl group, or an alkoxy group; r2 to r4 and r6 to r8 represent a hydrogen atom, an alkyl group, an aryl group, or an alkoxy group; x1 and x2 represent a single bond, —o—, —co—, —s—, —so2—, —nh—, or —ch2—; and l1 represents a divalent linking group.. ... Fujifilm Corporation

03/12/15 / #20150068419

Resin composition for laser engraving, flexographic printing plate precursor for laser engraving and process for producing same, and flexographic printing plate and process for making same

Disclosed is a resin composition for laser engraving, comprising (component a) a hydrocarbon-based plastomer and (component b) a polyester resin.. . ... Fujifilm Corporation

03/05/15 / #20150066530

Medical care data display control device, method and program

. . . . . . A medical care data display control device for displaying medical care data of a plurality of items obtained in chronological order is disclosed. The device includes: a hidden time period determining length setting unit in which a hidden time period determining length used to determine whether or not to hide a part of a displayed time period of the medical care data is set; a determination unit that determines whether or not there is a time period which contains no medical care data and is equal to or longer than the hidden time period determining length; and a display control unit that hides, if it is determined by the determination on unit that there is a time period which contains no medical care data and is equal to or longer than the hidden time period determining length, all or a part of the time period which contains no medical care data.. ... Fujifilm Corporation

03/05/15 / #20150065885

Ultrasonic signal processing device and ultrasonic signal processing method

An ultrasonic signal processing method includes: acquiring pieces of element data output from each element included in an ultrasonic probe including multiple elements configured to transmit an ultrasonic wave to a subject, receive an ultrasonic wave reflected by the subject and output an ultrasonic detection signal; determining element data to be preserved, according to depth information on a reception echo at an acquisition time of the element data, among the pieces of element data of each of the acquired elements; and preserving the element data determined to be preserved.. . ... Fujifilm Corporation

03/05/15 / #20150065880

Ultrasound diagnostic device, sound velocity derivation method and program

An estimated value of sound velocity of a subject interior is derived more stably and with higher accuracy. A phasing processing section provides, to each of received signals that were generated by piezoelectric elements respectively, respective delay times that were computed on the basis of each of plural set sound velocities, and phases the received signals per set sound velocity. ... Fujifilm Corporation

03/05/15 / #20150065802

Light source apparatus and endoscope system

A light source apparatus outputs light for an endoscope apparatus. A blue led emits blue light with a peak wavelength equal to or longer than 450 nm. ... Fujifilm Corporation

03/05/15 / #20150065798

Electronic endoscope device and imaging module therefor

Provided are an imaging module for an endoscope that favorably blocks incidence of flare light to an imaging element and an electronic endoscope device including the same. The imaging module for an endoscope includes an objective lens optical system; a transparent optical member 56; an imaging element 58 that is of a microlens non-mounting type; an adhesive layer; and a light shielding mask 121 for a measure against flare that is interposed between a light emission surface 56a and a light incidence surface, is formed with an opening 121a, which matches an image circle that passes through the objective lens optical system and the transparent optical member 56 and is formed on the light incidence surface of the imaging element 58 and has a smaller diameter than the image circle, and is provided immediately before the light incidence surface of the imaging element 58.. ... Fujifilm Corporation

03/05/15 / #20150065797

Electronic endoscope device, imaging module, and image pick-up lens molding method

The invention provides an electronic endoscope device, an imaging module, and an image pick-up lens molding method that can prevented dew formation of an objective lens optical system and facilitate manufacture. An objective lens optical system of an imaging module includes a tip lens 50a in which a tip surface and a back surface are formed in a plane, and a recess s is formed; a plane plate 50b that block the recess s; and a lens barrel 51a that integrally molds and forms the entire outer peripheral surfaces of the tip lens 50a and the plane plate 50b with resin, while a state is maintained where the plane plate 50b is pressed against the tip lens 50a, and the plane plate 50b and the back surface of the tip lens 50a are directly brought into close contact with each other at an entire joining surface therebetween.. ... Fujifilm Corporation

03/05/15 / #20150065796

Optical unit, endoscope apparatus, and manufacturing method of optical unit

An optical unit includes: a cylindrical member whose thickness varies in a circumferential direction; a transparent member disposed at one end, in an axial direction, of the cylindrical member; and a joining member which joins the transparent member to the cylindrical member and thereby seals the cylindrical member at the one end in the axial direction, and a portion, joining a side surface of the transparent member to an inner circumferential surface of the cylindrical member, of the joining member is thicker at a position where the cylindrical member is thick than at a position where the cylindrical member is thin.. . ... Fujifilm Corporation

03/05/15 / #20150064500

Composition for magnetic recording medium and magnetic recording medium

An aspect of the present invention relates to a composition, which is a composition for a magnetic recording medium and comprises an isocyanate compound in the form of an adduct of a polyhydroxyl compound having one or more aromatic carbon rings and three or more hydroxyl groups per molecule with a polyisocyanate having two or more isocyanate groups per molecule.. . ... Fujifilm Corporation

03/05/15 / #20150064423

Inkjet ink composition, image recording method, and image-recorded material

The invention provides an inkjet ink composition, including at least: a water-soluble polymer which has a number average molecular weight of 1,000 or more; particles which have a polymerizable group; a colorant; and water, a ratio of a content of the particles to a content of the water-soluble polymer in terms of mass being from 0.6 to 3.5, and a viscosity of the inkjet ink composition at 30° c. Being from 10 mpa·s to 14 mpa·s. ... Fujifilm Corporation

03/05/15 / #20150064398

Image formation method, decorative sheet, decorative sheet molding, process for producing in-mold molded product, in-mold molded product, and ink set

The object of the present invention is to provide an image formation method that can give an image that is excellent in terms of adhesion to a substrate, blocking resistance of a resulting printed material, and molding suitability, in particular vacuum forming properties, and that can suppress post-molding cracking of a molding. Disclosed is an image formation method comprising, in order, step a: a step of applying liquid a to a substrate, step b: a step of irradiating the applied liquid a with actinic radiation so as to carry out complete curing or semi-curing up to a degree of cure of at least 90%, step c: a step of applying liquid b to a cured layer of the completely cured or semi-cured liquid a, and step d: a step of completely curing liquid a and liquid b.. ... Fujifilm Corporation

03/05/15 / #20150062726

Imaging lens and imaging apparatus including the same

The imaging lens substantially consists of a first lens having a biconvex shape, a second lens having a negative refractive power, a third lens having a negative refractive power and a convex surface that faces the object side, a fourth lens having a positive refractive power, and a fifth lens having a negative refractive power, of which at least one of the object-side surface and the image-side surface has at least one inflection point, in this order from the object side; and wherein conditional expression (1a): −0.38<f/f45<−0.01 is satisfied. This conditional expression is related to the focal length f of the entire system and the combined focal length f45 of the fourth lens and the fifth lens.. ... Fujifilm Corporation

03/05/15 / #20150062674

Color separation apparatus, color separation method, and non-transitory computer-readable medium

A color separation apparatus comprising: a target value acquisition device; a dot threshold data candidate selection device; a print profile acquisition device which acquires a print profile showing correspondence between device signal values and color system values in the printer for each of the candidates of dot threshold data; and a color separation device which allows the printer to calculate candidates of the device signal values on the basis of the target values of colors acquired by the target value acquisition device and the print profile, and determines dot threshold data for reproducing colors corresponding to the target values on the basis of the candidates of dot threshold data and the print profile from among the candidates of dot threshold data, as well as determines device signal values for reproducing colors corresponding to the target values from among the candidates of device signal values.. . ... Fujifilm Corporation

03/05/15 / #20150062673

Color separation apparatus, color separation method, and non-transitory computer readable medium

A color separation apparatus comprising: a target value acquisition device; a dot threshold data acquisition device which acquires dot threshold data including information on a threshold for each of the dots for converting the continuous-tone image data into binary image data for each of the color materials; a print profile acquisition device which acquires a print profile showing correspondence between a device signal value and a value of a color system in the printer; and a color separation device which allows the printer to calculate candidates of the device signal value on the basis of the target values of colors acquired by the target value acquisition device and the print profile, and determines a device signal value for reproducing colors corresponding to the target values from among the candidates of the device signal value on the basis of the dot threshold data and the print profile.. . ... Fujifilm Corporation

03/05/15 / #20150062641

Image display control apparatus, method, non-transitory computer readable recording medium, and image display system

There are provided an image display control device, an image display control method, an image display control program, and an image display system that can efficiently select desired image information without spending a lot of time even if the amount of image information to be searched for is significantly large. In a standard scale obtained by matching the full range of the identification number with the entire position of a bar portion of a track bar, at a peripheral position of each slider, each identification number is assigned according to an enlarged scale that is larger than the standard scale. ... Fujifilm Corporation

03/05/15 / #20150062502

Polarization plate and liquid crystal display

A polarization plate includes a first protective film, a polarizer, and a second protective film in this order, in which the first protective film is a film including a (meth)acryl-based resin, a thickness of the first protective film is in a range of 20 μm to 30 μm, a thickness of the second protective film is in a range of 1.5 times to 1.8 times of the thickness of the first protective film, and a humidity dimensional change ratio of the second protective film in the direction orthogonal to an absorption axis of the polarizer is in a range of 0.45% to 0.8%.. . ... Fujifilm Corporation

03/05/15 / #20150062400

Signal processing apparatus

An imaging element 5 includes an imaging pixel cell 30 and focus detecting pixel cells 31r and 31l. The digital signal processing unit 17 determines which one of interpolation processing and gain correction processing is to be performed using at least the f value at the time of imaging. ... Fujifilm Corporation

03/05/15 / #20150062386

Imaging device and signal correcting method

A digital signal processing unit 17 of a digital camera which includes a solid-state imaging element 5 having an imaging pixel cell 30 and a pair of focus detecting pixel cells 31r and 31l determines whether a captured image signal obtained by imaging by the imaging element 5 has a region affected by at least one of the flare and the ghost. And, when it is determined that there is the region, the digital signal processing unit 17 performs correction processing by signal interpolation using an output signal of imaging pixel cells around the focus detecting pixel cell included in the captured image signal on an output signal of all the focus detecting pixel cells included in the captured image signal.. ... Fujifilm Corporation

03/05/15 / #20150062384

Image processing device, imaging device, image processing method, and non-transitory computer readable medium

A device includes: an image acquisition device acquiring a taken image in which a subject is imaged; a smoothing device generating a smoothed image by smoothing the taken image; a noise extraction device extracting a difference noise component from a difference between the taken image and the smoothed image; a noise addition device adding the difference noise component to the smoothed taken image; a map acquisition device acquiring a blurring strength map that represents a distribution of blurring strengths for the taken image; and an image combining device combining the taken image with the smoothed image on the basis of the blurring strength map, and generating an output image.. . ... Fujifilm Corporation

03/05/15 / #20150062265

Ink composition, inkjet recording ink, and inkjet recording method

There is provided an ink composition which at least contains a first color material and a second color material, in which the first color material is a compound represented by formula (a-i) described in the specification, and the second color material is at least one compound selected from a compound represented by formula (b-i) described in the specification and a compound represented by formula (b-v) described in the specification.. . ... Fujifilm Corporation

03/05/15 / #20150062238

Black ink composition, ink set, and image forming method

A black ink composition includes: carbon black and a water-insoluble resin that covers at least a part of the surface of the carbon black; a cyan pigment and a water-insoluble resin that covers at least a part of the surface of the cyan pigment; a magenta pigment and a water-insoluble resin that covers at least a part of the surface of the magenta pigment; water-insoluble resin particle; and water, wherein a content ratio of the carbon black is from 1.0 to 2.0% by mass with respect to the total mass of the composition, and a total amount of pigments is from 1.8 to 3.5% by mass with respect to the total mass of the composition. The black ink composition can be used in an ink set and an image forming method.. ... Fujifilm Corporation

03/05/15 / #20150062233

Image recording apparatus, and method and recording medium for optimizing defective-recording-element compensation parameter

In the optimization of a non-discharge correction parameter for correcting a non-discharge using a non-discharge correction nozzle, a first test chart including a non-recording region that is the recording position of the non-discharge correction nozzle, a measurement chart region where a measurement chart is formed, and a uniform concentration region is formed for a designated nozzle that is previously designated. Then, the first test chart is read, the reading data is analyzed, the concentration at the measurement chart and the concentration at the uniform concentration region are compared for each non-discharge correction parameter, and a non-discharge correction parameter corresponding to the concentration at the measurement chart that minimizes the concentration difference from the uniform concentration region is derived as the optimum value of the non-discharge correction parameter for the designated nozzle.. ... Fujifilm Corporation

03/05/15 / #20150062224

Ink jet recording apparatus and method

The present invention relates to an ink jet recording apparatus and method. In an aspect of the present invention, uneven concentration correction and non-ejection correction are performed at the time of drawing an image. ... Fujifilm Corporation

03/05/15 / #20150060839

Photoelectric conversion device and imaging device using the same

An organic photoelectric conversion device having a pair of electrodes and a light receiving layer which includes at least a photoelectric conversion layer and is sandwiched by the electrodes, the device including an electron blocking layer provided between the photoelectric conversion layer and one of the electrodes, and a hole blocking layer provided between the photoelectric conversion layer and the other of the electrodes, in which the hole blocking layer is a layer that includes a fullerene and/or a fullerene derivative and a transparent hole transport material having an ionization potential of 5.5 ev or more.. . ... Fujifilm Corporation

03/05/15 / #20150060678

Radiation image detection device and method for manufacturing same

There are provided a method for manufacturing a radiation image detection device, which can cover a scintillator without damaging the scintillator and which can easily form a scintillator protection film with a peripheral portion having a high adhesion to a substrate, and the radiation image detection device. A scintillator protection film that covers a planar scintillator provided on a photoelectric conversion panel is brought into close contact with a scintillator and the photoelectric conversion panel by a planar member having a surface with an irregular shape, and an irregular shape is formed on the scintillator protection film along the irregular shape of the planar member. ... Fujifilm Corporation

03/05/15 / #20150059605

Resin composition for laser engraving, flexographic printing plate precursor for laser engraving and process for producing same, and flexographic printing plate and process for making same

Disclosed is a resin composition for laser engraving comprising (component a) a polymer having a monomer unit derived from a conjugated diene-based hydrocarbon, (component b) a compound having an acid group and an ethylenically unsaturated bond; and (component c) a polymerization initiator.. . ... Fujifilm Corporation

02/26/15 / #20150057542

Ultrasound diagnostic device, ultrasound diagnostic method and ultrasound diagnostic program storage medium

An ultrasound diagnostic device includes an ultrasound probe including plural ultrasound transducers that transmit ultrasound toward an imaging subject, receive ultrasound reflected from the imaging subject, and output ultrasound detection signals; an alteration unit that alters transmission frequencies of the ultrasound transmitted from the ultrasound probe or reception frequencies of the ultrasound received by the ultrasound probe; and a calculation unit that calculates an index for diagnosing a tissue characteristic based on a relationship between reception signals of at least two different ultrasound transducers for at least two different frequencies of the transmission frequencies or reception frequencies altered by the alteration unit.. . ... Fujifilm Corporation

02/26/15 / #20150057534

Photoacoustic image generation apparatus, system and method

A photoacoustic wave induced in a subject to be examined by illumination of the subject to be examined with light is detected. A first photoacoustic image corresponding to a frequency component less than or equal to a predetermined frequency and a second photoacoustic image corresponding to a frequency component higher than a predetermined frequency are generated based on a detection signal of the detected photoacoustic wave. ... Fujifilm Corporation

02/26/15 / #20150057324

Tablet containing 5-hydroxy-1h-imidazole-4-carboxamide

The tablet containing (1) 5-hydroxy-1h-imidazole-4-carboxamide or a salt thereof, or a hydrate thereof, and (2) silicon dioxide has a high content of 5-hydroxy-1h-imidazole-4-carboxamide or a salt thereof, or a hydrate thereof and an easily takable size as a tablet, and shows superior dissolution property.. . ... Fujifilm Corporation

02/26/15 / #20150055753

Radiation imaging system and operating method thereof

A console acquires a displacement amount of an x-ray source from a displacement amount detector. In the case where an electronic cassette having an image detector is not appropriately positioned with respect to a body part to be imaged, a position of the x-ray source is changed in accordance with a position of the body part to be imaged. ... Fujifilm Corporation

02/26/15 / #20150055752

X-ray exposure control device, x-ray image detection apparatus, and x-ray imaging system

An x-ray exposure control device comprises: an x-ray detection element including a plurality of pixels for dose detection each detecting a dose during x-ray radiation; a region setting unit configured to set a use pixel region including pixels for use in dose detection from the plurality of pixels for dose detection during the x-ray radiation; a signal generating unit configured to generate a stop signal for stopping the x-ray radiation from an x-ray source according to the dose detected by each of the pixels for use in the dose detection within the use pixel region set by the region setting unit; and a transmission unit configured to transmit to the x-ray source the stop signal to stop the x-ray radiation as generated by the signal generating unit.. . ... Fujifilm Corporation

02/26/15 / #20150055062

Optical film, polarizer and liquid crystal display device

An optical film, has a film thickness of 15 μm to 45 μm, rth (440 w, 30% rh) and “rth (440 w, 30% rh)−rth (440 w, 80% rh)” of the optical film satisfy expression (1) −20 nm≦rth (440 w, 30% rh)≦5 nm and expression (2) 0 nm≦rth (440 w, 30% rh)−rh (440 w, 80% rh)≦18 nm, here, in expressions (1) and (2), rth (440 w, 30% rh) represents a retardation value in a film thickness direction at a wavelength of 440 nm measured at 25° c. And at a relative humidity of 30% and rth (440 w, 80% rh) represents a retardation value in the film thickness direction at a wavelength of 440 nm measured at 25° c. ... Fujifilm Corporation

02/26/15 / #20150055011

Image device and focus control method

When reliability of a defocus amount which is calculated using a signal from a region 50a is low, a digital camera expands the phase difference detection target region to the regions 50a, 50b, and 50c. Further, the digital camera calculates a defocus amount using a correlation operation result of an output signal group of pixel cells 31r in an odd numbered column and an output signal group of the pixel cells 31l in an odd numbered column and a correlation operation result of an output signal group of pixel cells 31r in an even numbered column and an output signal group of the pixel cells 31l in an even numbered column, in the regions 50a, 50b, and 50c.. ... Fujifilm Corporation

02/26/15 / #20150054926

Image processing device and method, and image capturing device

An image processing device comprising: an image acquisition device; a parallax acquisition device; a first data transform device; an operation processing device; and a second data transform device transforming third frequency component data and fourth frequency component data respectively corresponding to the third image and the fourth image calculated by the operation processing device into data on a real space and for respectively selecting pixels at positions corresponding to the target pixels as one pixel of the third image and one pixel of the fourth image.. . ... Fujifilm Corporation

02/19/15 / #20150051408

Packaged product of solid preparation containing 5-hydroxy-1h-imidazole-4-carboxamide or salt thereof, or hydrate thereof

. . The present invention provides a packaged product of a solid preparation containing 5-hydroxy-1h-imidazole-4-carboxamide or a salt thereof, or a hydrate thereof, which comprises the solid preparation and an environment-controlling agent packaged together. The packaged product of present invention is useful as a packaged product of a solid preparation containing 5-hydroxy-1h-imidazole-4-carboxamide or a salt thereof, or a hydrate thereof, with which discoloration of the solid preparation is suppressed, and superior storage stability of the solid preparation is obtained.. ... Fujifilm Corporation

02/19/15 / #20150050737

Method for culturing pluripotent stem cell, and polypeptide to be used therefor

A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by csyyqsc (seq id no:1) and an amino acid sequence represented by rgd; and (2) a second region containing (2-i) an amino acid sequence represented by prpslakkqrfrhrnrkgyrsqrghsrgrnqn (seq id no:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by seq id no:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by seq id no:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.. . ... Fujifilm Corporation

02/19/15 / #20150050551

Non-aqueous liquid electrolyte for secondary battery and secondary battery

A non-aqueous liquid electrolyte for a secondary battery, containing: an electrolyte; a polymerizable monomer; and a polymerization initiator in an organic solvent, in which the polymerization initiator has an element of group xiii of the periodic table as a central element thereof and contains a compound capable of producing a radical and a lewis acid in the liquid.. . ... Fujifilm Corporation

02/19/15 / #20150050480

Gas barrier film

The present invention provides, as gas barrier film having improved adhesiveness between a base material and a barrier laminate, a gas barrier film comprising a plastic film, an organic layer and an inorganic layer in this order, the gas barrier film having an aluminium compound layer containing one or more compounds selected from the group consisting of aluminium oxide, aluminium nitride and aluminium carbide between the plastic film and the organic layer; the plastic film and the aluminium compound layer, and the aluminium compound layer and the organic layer being directly in contact to each other respectively; the thickness of the aluminium compound layer being 40 nm or less; and the organic layer being a layer formed of a composition containing a polymerizable compound and a phosphate compound.. . ... Fujifilm Corporation

02/19/15 / #20150050479

Gas barrier film

The present invention provides, as gas barrier film having improved adhesiveness between a base material and a barrier laminate, a gas barrier film including a plastic film, an organic layer and an inorganic layer in this order, the gas barrier film having a silicon compound layer including one or more compounds selected from the group consisting of silicon oxide, silicon nitride and silicon carbide between the plastic film and the organic layer; the plastic film and the silicon compound layer, and the silicon compound layer and the organic layer being directly in contact to each other respectively; the thickness of the silicon compound layer being 40 nm or less; the organic layer being a layer formed of a composition containing a polymerizable compound and a silane coupling agent; and the thickness of the inorganic layer being larger than the thickness of the silicon compound layer.. . ... Fujifilm Corporation

02/19/15 / #20150050478

Gas barrier film and manufacturing method of gas barrier film

A gas barrier film including a substrate of which the surface is formed of an organic material; an inorganic film which is formed on the substrate and contains silicon nitride; and a mixed layer which is formed in an interface between the substrate and the inorganic film, and contains components derived from the organic material and the inorganic film, wherein a compositional ratio n/si between nitrogen and silicon contained in the inorganic film is 1.00 to 1.35, the inorganic film has a film density of 2.1 g/cm3 to 2.4 g/cm3 and a film thickness of 10 nm to 60 nm, and the mixed layer has a thickness of 5 nm to 40 nm.. . ... Fujifilm Corporation

02/19/15 / #20150050378

Lens forming apparatus

The invention provides a lens forming apparatus that can suppress generation of burrs even if gaps between outer walls of an upper die and a lower die and an inner wall of a trunk die is made wide. A lens forming apparatus 11 according to the present invention includes a trunk die 12 having a through-hole 17 therein; first and second dies 13 and 14 that are fitted into the through-hole 17 from both ends thereof, respectively, and have pressing surfaces 20 and 30 for sandwiching and pressing a forming material 24; and induction-heating coils 15 and 16 that heat the first and second dies 13 and 14 to a temperature equal to or higher than a glass transition point, in a state where the trunk die 12 is not heated and the temperature thereof is set to a temperature equal to or lower than the glass transition point.. ... Fujifilm Corporation

02/19/15 / #20150049858

Radiographic image detector, radiographic imaging apparatus, radiographic imaging system

The present invention provides a radiographic image detector that may maintain even resolution in 6 directions before and after 3-pixel binning process or 4-pixel binning process. A radiation detector is disposed with plural pixels that have hexagonal shaped pixel regions, arrayed in a honeycomb pattern. ... Fujifilm Corporation

02/19/15 / #20150049582

Ultrasonic signal processing device and ultrasonic signal processing method

An ultrasonic signal processing method includes: measuring a sound velocity in a subject according to transmission/reception data acquired in ultrasonic transmission of m times (m is an integer equal to or greater than 1 and less than n) along different transmission focus lines among ultrasonic transmission of n times (n is an integer equal to or greater than 2) along multiple transmission focus lines in a case where ultrasonic transmission is sequentially performed at least one time on each of multiple transmission focus lines to create an ultrasonic image for one frame.. . ... Fujifilm Corporation

02/19/15 / #20150049366

Quantization method, image processing apparatus, and recording medium

A quantization method according to an aspect of the present invention includes the steps of quantizing a first image data by the use of a basic pattern and converting the first image data into a second image data that represents a binary or multi-level quantized pattern having a gray level smaller than that of the first image data. The basic pattern according to this aspect of the present invention presents high frequent occurrence of the basic tone patterns and a mostly uniform-distributed pattern of the clusters of different kinds of the basic tone patterns in the image with the long-distance autocorrelation (periodicity) of the basic tone patterns suppressed. ... Fujifilm Corporation

02/19/15 / #20150049149

Inkjet recording method and printed material

An inkjet recording method including applying an undercoat solution onto a transparent recording medium, semi-curing the undercoat solution, discharging an ink composition onto the semi-cured undercoat solution, and carrying out overall curing of the semi-cured undercoat solution and the ink composition by exposure under an low oxygen atmosphere after the image formation, the undercoat solution comprising two or more types of polymers and/or oligomers from among polymers and oligomers having a structure selected from the group consisting of a polyester structure, a polyurethane structure, and a chlorinated polyolefin structure, the ink composition comprising at least 95 parts of a polyfunctional ethylenically unsaturated compound relative to 100 parts of the total content of ethylenically unsaturated compound, and at least 5 parts of a polyalkylene glycol diacrylate, and exposure in the overall curing being carried out from both the image formation face and the reverse face of the recording medium.. . ... Fujifilm Corporation

02/19/15 / #20150049136

Method, apparatus, and system to provide multi-pulse waveforms with meniscus control for droplet ejection

A method, apparatus, and system are described herein for driving a droplet ejection device with multi-pulse waveforms. In one embodiment, a method for driving a droplet ejection device having an actuator includes applying a multi-pulse waveform with a drop-firing portion having at least one drive pulse and a non-drop-firing portion to an actuator of the droplet ejection device. ... Fujifilm Corporation

02/19/15 / #20150048352

Wafer for forming imaging element, method for manufacturing solid-state imaging element, and imaging element chip

A wafer for forming an imaging element has a test pattern and a plurality of imaging element units. The wafer has an imaging region which includes a great number of photoelectric conversion pixels, an imaging element units and a test pattern. ... Fujifilm Corporation

02/12/15 / #20150045667

Ultrasound diagnostic apparatus and data processing method

In the ultrasound diagnostic apparatus, the ultrasonic wave transmitter/receiver transmits and receives an ultrasonic beam to a subject to generate reception data using ultrasonic wave transmission/reception elements arranged in one direction; the delay correction unit corrects a delay time of the reception data to align a phase of the reception data; the reception aperture range determination unit determines a reception aperture range of reception data, which is used when producing an ultrasound image from reception data after correction of the delay time, based on a signal value of the reception data after correction of the delay time in an arrangement direction of the ultrasonic wave transmission/reception elements; and the image producer produces an ultrasound image by performing phase matching addition of the reception data after correction of the delay time corresponding the reception aperture range and performing data processing.. . ... Fujifilm Corporation

02/12/15 / #20150045339

Nitrogen-containing heterocyclic compound or salt thereof

The object is to provide an fms-like tyrosine kinase 3 (flt3) inhibitor useful as a therapeutic agent for acute myeloid leukemia (aml). A novel nitrogen-containing heterocyclic compound represented by the general formula [1] or a salt thereof is provided. ... Fujifilm Corporation

02/12/15 / #20150044616

Method of forming patterns

A method of forming patterns includes (a) coating a substrate with a resist composition for negative development to form a resist film, wherein the resist composition contains a resin capable of increasing the polarity by the action of the acid and becomes more soluble in a positive developer and less soluble in a negative developer upon irradiation with an actinic ray or radiation, (b) forming a protective film on the resist film with a protective film composition after forming the resist film and before exposing the resist film, (c) exposing the resist film via an immersion medium, and (d) performing development with a negative developer.. . ... Fujifilm Corporation

02/12/15 / #20150044612

Lithographic printing plate precursors and processes for preparing lithographic printing plates

Lithographic printing plates and processes for preparing the lithographic printing plates are provided. The plates have excellent printing durability, staining resistance and staining resistance over time. ... Fujifilm Corporation

02/12/15 / #20150043836

Image processing method, image processing device, image forming device and inkjet recording device

An image processing method includes: storing a threshold matrix for quantization processing of input image data, applying mask processing to an abnormal recording element based on abnormal recording element information, correcting a correspondence relationship between a recording element and a threshold such that processing of a pixel to be formed by the abnormal recording element subjected to mask processing is excluded and the continuity of a pattern of the threshold matrix is maintained, and performing quantization processing using a corrected threshold matrix.. . ... Fujifilm Corporation

02/12/15 / #20150043715

Radiographic imaging device, radiographic imaging system, control method of radiographic imaging device and program storage medium

A radiographic imaging device includes: a radiation detector including plural pixels, each including a sensor portion and a switching element; a detection unit that detects a radiation irradiation start if an electrical signal caused by charges generated in the sensor portion satisfies a specific irradiation detection condition, and/or if an electrical signal caused by charges generated in a radiation sensor portion that is different from the sensor portion satisfies a specific irradiation detection condition; and a control unit that determines whether or not noise caused by external disturbance has occurred after the detection unit has detected the radiation irradiation start, and if the noise has occurred, that stops a current operation of the radiation detector, and causes the detection unit to perform detection.. . ... Fujifilm Corporation

02/12/15 / #20150043105

Head cleaning device and drive device

A head cleaning device includes: a wiper member formed in an elongate shape and having a wiper anchoring portion anchored so as not to move in a tape width direction; and a support member that includes a wiper entrainment portion about which the wiper member is entrained so as to double back, that causes the wiper entrainment portion to move in the tape width direction so that a surface of the wiper member at an opposite side of the wiper entrainment portion from the wiper anchoring portion wipes a head that performs at least one of writing information to, or reading information from, a recording tape.. . ... Fujifilm Corporation

02/12/15 / #20150043104

Tape cleaning device and drive device

A tape cleaning device includes a blade that, while touching a recording tape that is running, scrapes foreign bodies from the recording tape; a roller that touches the recording tape and rotates along with the running of the recording tape, the foreign bodies scraped off by the blade being transferred to the roller; and a removal mechanism that removes the foreign bodies that have been transferred to the roller from the roller.. . ... Fujifilm Corporation

02/12/15 / #20150042732

Polymeric dispersants, dispersions, processes for preparing dispersions and the use of polymeric dispersants

A polymeric dispersant obtained or obtainable by copolymerising a monomer composition comprising at least the components: i) benzyl (meth)acrylate; ii) propylene glycol (meth)acrylate; wherein the weight ratio of component i) to component ii) is greater than 10:1.. . ... Fujifilm Corporation

02/12/15 / #20150042717

Image processing method, image processing device, image forming device and inkjet recording device

An image processing method includes: applying mask processing to an abnormal recording element based on abnormal recording element information; converting input image data such that a pixel to be formed by the abnormal recording element is excluded; applying quantization processing that converts the converted input image data to image data having a gradation number less than a gradation number of the converted input image data; and assigning each pixel forming image data after quantization processing to a normal recording element.. . ... Fujifilm Corporation

02/12/15 / #20150040467

Method for culturing microalgae, biofilm formed on liquid surface by the culturing method, biomass and oil obtained from the biofilm, method for collecting the biofilm, method for producing biomass fuel, microalgae capable of forming biofilm on liquid surface, biofilm formed on liquid surface using the microalgae, and biomass and oil obtained from the biofilm

There is provided a method for culturing microalgae in which microalgae capable of forming a biofilm on a liquid surface are cultured so as to form a biofilm on a liquid surface of a liquid medium, and microalgae capable of forming the biofilm on the liquid surface, for example, microalgae closely related to botryococcus sudeticus.. . ... Fujifilm Corporation

02/05/15 / #20150038847

Ultrasound diagnostic apparatus

. . The ultrasound probe transmits and receives ultrasonic waves in different directions and the diagnostic apparatus body combines a plurality of images captured in the different directions of transmission and reception to produce an ultrasound image. In this process, the ultrasound diagnostic apparatus measures the temperature of the ultrasound probe to change the ultrasound transmission and reception for producing a composite ultrasound image or makes the directions of transmission and reception in the last ultrasound image in one composite ultrasound image coincide with those in the first ultrasound image in its temporally adjacent composite ultrasound image. ... Fujifilm Corporation

02/05/15 / #20150038825

Photoacoustic measurement device and probe for photoacoustic measurement device

An object of the invention is to reduce the size of a probe for a photoacoustic measurement device. A light guide 71 is arranged such that one of a two side surfaces 71a is closer to a probe axis c which faces a subject than the other side surface and a light emission end surface 71c is closer to the probe axis c than a light incident end surface 71b when the probe is used. ... Fujifilm Corporation

02/05/15 / #20150037546

Coloring composition for inkjet textile printing, textile printing method, and fabric

A coloring composition for inkjet textile printing, containing water and a dye represented by formula (i) [r1 represents h, halogen, alkyl, aralkyl, aryl, heteroaryl, alkoxy, or cyano; r2 represents h, halogen, cyano, —coor6, —cor7, —conr8r9, or an ionic hydrophilic group; r3 represents alkyl, aralkyl, alkenyl, alkynyl, aryl, or heteroaryl; each of r4 and r5 independently represents h, alkyl, cycloalkyl, aralkyl, alkenyl, alkynyl, aryl, or heteroaryl; r15 represents h or a substituent; x represents alkyl, cycloalkyl, aralkyl, aryl, heteroaryl, —cor12, or —conr13r14; r6 represents alkyl, aryl, or heteroaryl; each of r7 to r14 independently represents h, alkyl, aryl, or heteroaryl; and a number of ionic hydrophilic groups in one molecule is from 1 to 5].. . ... Fujifilm Corporation

02/05/15 / #20150036802

Radiation image detecting device and radiation imaging system

In a detection panel, plural pixels which receive x-ray and accumulate electric charge and plural measuring pixels which detect x-ray dose are provided on an imaging surface. The plural measuring pixels are arranged periodically with an interval. ... Fujifilm Corporation

02/05/15 / #20150036239

Tape recording medium and drive device

A tape recording medium includes: a tape member including a recording tape and an exposure tape that is connected to the recording tape and in which an exposure portion for exposing a portion of a head in a tape width direction is formed, the head doing at least one of writing information to and reading information from the recording tape; and a pair of reels to which free ends of the tape member are connected and which retain the tape member such that the pair of reels can pay out and take up the tape member.. . ... Fujifilm Corporation

02/05/15 / #20150036228

Lens for projection and projection-type display apparatus

A lens for projection substantially consists of a negative first lens group, a positive second lens group and a positive third lens group in this order from a magnification side. A reduction side is telecentric, and a most magnification-side lens is an aspheric plastic lens. ... Fujifilm Corporation

02/05/15 / #20150036151

Device and method for stereoscopic image printing

A method for stereoscopic image printing according to one aspect of the presently disclosed subject matter includes acquiring information on distribution of parallax of a multi-viewpoint image with two or more viewpoints; determining, based on the information on the distribution of parallax, a number of viewpoints of a stereoscopic image which is printed on a lenticular lens sheet; generating, if the number of viewpoints of the multi-viewpoint image is smaller than the determined number of viewpoints, a shortfall viewpoint image based on the inputted multi-viewpoint image; and printing a stereoscopic image which is made of the multi-viewpoint image and the generated viewpoint image.. . ... Fujifilm Corporation

02/05/15 / #20150036086

Liquid crystal display device

A liquid crystal display device includes: a first polarizer; a liquid crystal cell including a liquid crystal layer containing liquid crystal molecules aligned in parallel with a substrate of the liquid crystal cell; a first compensation film; and a second polarizer, wherein, as viewed perpendicularly to the substrate, an absorption axis of the first polarizer is parallel with an optical axis of the first compensation film, and an angle φ between the absorption axis of the first polarizer and an optical axis of the liquid crystal layer satisfies 0°<φ, in a cross section of the liquid crystal cell as viewed along a transmission axis of the first polarizer, an optical axis of the liquid crystal layer and the optical axis of the first compensation film have a tilt angle in the same direction to a face of the substrate, and the first compensation film has a positive birefringence.. . ... Fujifilm Corporation

02/05/15 / #20150036025

Image display device, imaging apparatus mounted with image display device as finder device, and image display method

An image display device includes a beam splitter that splits an incident light entering from a subject side, an imaging device that converts a first optical image generated by an one-side incident light split by the beam splitter into an electrical signal and outputs the converted electrical signal as a capture image, a synthesis image generating unit that generates an electronic information image, a display panel that displays the electronic information image, and an optical prism that emits an optical image of the electronic information image projected from the display panel to be superimposed on a second optical image generated by the other-side split incident light.. . ... Fujifilm Corporation

02/05/15 / #20150036022

Image capturing apparatus, image capturing method, and program

An image capturing apparatus extracts frequency components from image data of a newly captured photograph, divides them into divided sections, compares the frequency components of each of the divided sections of the newly captured photograph and frequency components of corresponding divided sections of a database, obtains a maximum vicinity area, and replaces first extraction components, which are a portion of components extracted from among frequency components outside the maximum vicinity area of each of the divided sections of the newly captured photograph, with second extraction components, which are a portion of components extracted from among frequency components outside the maximum vicinity area of corresponding divided sections of the database, at positions of the frequency components of the newly captured photograph corresponding to the positions of the second extraction components.. . ... Fujifilm Corporation

02/05/15 / #20150035894

Ink and printing process

An ink comprising an encapsulated particulate solid and a liquid vehicle wherein: i) the encapsulated particulate solid comprises a particulate solid encapsulated with a cross-linked dispersant shell; and ii) the ink comprises the components: a.from 0.1 to 20 parts of the encapsulated particulate solid; b.from 20 to 40 parts of glycerol; c.from 1 to 30 parts of ethylene glycol; d.from 0 to 20 parts of 2-pyrrolidone; e.from 0.01 to 3 parts of surfactant; f.from 0 to 10 parts of water-soluble polymer; g.from 0 to 20 parts of polymer particles; h.from 0 to 2 parts of biocide; i.from 20 to 75 parts of water; wherein all the parts are by weight and the sum of the components a. To i. ... Fujifilm Corporation

02/05/15 / #20150035829

Medical image display control apparatus, medical image display control method, and medical image display control program

A functional image generating section that generates a functional image that represents the functions of a subject, based on 3d medical image data obtained by imaging the subject; a projected 3d image generating section that generates a projected 3d image that represents the appearance of the subject, based on the 3d medical image data; a display control section that displays the functional image and the projected 3d image; and a specified position data obtaining section that obtains position data regarding a position specified within the functional image, are provided. The projected 3d image generating section generates the projected 3d image which is projected in a projection direction such that a position within the projected 3d image corresponding to the specified position faces forward, based on the position data. ... Fujifilm Corporation

02/05/15 / #20150035205

Process for producing flexographic printing plate precursor for laser engraving, flexographic printing plate precursor for laser engraving, process for making flexographic printing plate, and flexographic printing plate

Objects of the present invention are to provide a process for producing a flexographic printing plate precursor for laser engraving that has excellent rinsing properties for engraving residue and can give a plate having excellent printing durability, to provide a flexographic printing plate precursor obtained by the process, and to provide a flexographic printing plate and a process for making the flexographic printing plate. Disclosed is a process for producing a flexographic printing plate precursor for laser engraving, comprising steps of: forming a relief-forming layer formed of a resin composition for laser engraving; and crosslinking the relief-forming layer by means of heat and/or light to thus obtain a flexographic printing plate precursor having a crosslinked relief-forming layer, wherein the resin composition for laser engraving comprises (component a) an n-vinyl compound, (component b) a polymerizable compound, (component c) an ethylenically unsaturated bond-containing binder polymer, and (component d) a polymerization initiator.. ... Fujifilm Corporation

02/05/15 / #20150033984

Cellulose acylate film, polarizing plate, manufacturing method of polarizing plate, and liquid crystal display device

There is provided a cellulose acylate film comprising a plasticizer and two or more kinds of ultraviolet absorbents specific in structure and has a moisture permeability of 1,000 to 1,700 g/m2·day at a temperature of 25° c. And relative humidity of 60%, and a polarizing plate containing at least one cellulose acylate film and a liquid crystal display device containing at least one polarizing plate.. ... Fujifilm Corporation

01/29/15 / #20150031999

Portable ultrasound systems with fine-grained power management associated devices, systems, and methods

Portable ultrasound systems and associated devices and methods for managing power in such systems are disclosed herein. In one embodiment, a method for conserving power in a portable ultrasound system includes disabling one or more first amplifiers and/or at least one or more first analog to digital converters (adcs) upon initiation of a first pulse repletion interval (pri). ... Fujifilm Corporation

01/29/15 / #20150030226

Diagnosis assistance apparatus, method and program

A first-image and a second-image representing the same organ of the same subject imaged at the same time are obtained, and an organ-region is extracted from the first-image. The extracted organ-region is displayed on a display screen. ... Fujifilm Corporation

01/29/15 / #20150030129

Radiation image detecting device and radiation imaging system

A detection panel has a plurality of pixels for accumulating electric charge by receiving x-rays, and a plurality of detection pixels for detecting an x-ray dose in an imaging surface. The detection pixels are disposed periodically with leaving space. ... Fujifilm Corporation

01/29/15 / #20150029597

Variable magnification optical system and imaging apparatus

A variable magnification optical system includes a negative first lens group, a stop, and a positive second lens group. The distance in an optical axis direction between the first and the second lens groups is reduced when magnification is changed from the wide angle end to the telephoto end. ... Fujifilm Corporation

01/29/15 / #20150029456

Laminate having optical anisotropy

Provided is an optically anisotropic body having good coatability onto a laminate, in which the laminate includes an optically anisotropic layer formed of a composition including a liquid crystal compound by direct coating, and an isotropic resin layer formed on the optically anisotropic layer by direct coating, and has good coatability onto the isotropic resin layer. The laminate includes an optically anisotropic layer and an isotropic resin layer formed of a resin composition directly coated on the optically anisotropic layer, in which the optically anisotropic layer is a layer formed by curing a liquid crystal composition including a liquid crystal compound containing a polymerizable group; the isotropic resin layer is the outermost layer of the laminate; and the surface energy on the side of the isotropic resin layer of the laminate is 34.0 mn/m or more.. ... Fujifilm Corporation

01/29/15 / #20150029445

Retardation film, polarizing plate, and liquid crystal display

A retardation film includes a first optically anisotropic layer having liquid crystal compounds fixed in a homogeneously aligned state and a leveling agent, and having an order parameter of 0.75 to 0.95 and a thickness of 0.3 to 3.0 μm; an intermediate layer including a resin having a solubility parameter sp value of 21.5 to 24.7, calculated by hoy's method, the intermediate layer having a thickness of 3.0 μm or less; and a second optically anisotropic layer having liquid crystal compounds fixed in a homeotropically aligned state, and having an order parameter op of 0.6 to 0.95 and a thickness of 0.3 to 3.0 μm, wherein op is represented by the following equation; op=(a∥−a⊥)/(2a⊥+a∥) where a∥ is absorbance of the liquid crystal compounds for light polarized parallel to an alignment direction, and a⊥ is absorbance of the liquid crystal compounds for light polarized perpendicular to the alignment direction.. . ... Fujifilm Corporation

01/29/15 / #20150029367

Color imaging apparatus

A color imaging apparatus comprising: a color imaging element comprising a plurality of pixels and color filters of a color filter array arranged on the plurality of pixels, the color filter array including first filters corresponding to a first color that most contributes to obtaining luminance signals and second filters corresponding to two or more second colors, and the first filters including two or more sections adjacent each other in horizontal, vertical, and oblique directions; a direction determination unit acquiring pixel values of pixels of the two or more sections of the first filters near a target pixel of demosaicking processing and determining a correlation direction of luminance; a demosaicking processing unit that calculates a pixel value of another color at a pixel position of the target pixel and that uses one or more pixels of another color in the correlation direction to calculate the pixel value.. . ... Fujifilm Corporation

01/29/15 / #20150029184

Three-dimensional model data generation device, method and program

A liver region extraction unit and a structural element extraction unit extracts the liver region and structural elements, such as the hepatic artery and the hepatic vein, from a three-dimensional image, and a surface data generation unit generates surface data of the liver region and surface data of the structural elements. A pattern adding unit adds a textured pattern to at least one of the surfaces of the liver region and the structural elements, and a data generation unit generate three-dimensional model data by combining the surface data of the liver region and the surface data of the structural elements after the addition of the textured pattern. ... Fujifilm Corporation

01/22/15 / #20150026632

Portable electronic device and display control method

. . . . According to an aspect of the present invention, setting change of a parameter can be performed while checking the content of all parameters on the list screen without screen transition of the list screen. Parameters of a desired page can be set at the same time even if a use condition or the like of the device is changed, or only part of the parameters can be corrected and set. ... Fujifilm Corporation

01/22/15 / #20150025382

Ultrasound diagnostic apparatus and method of producing ultrasound image

An ultrasound diagnostic apparatus includes an ultrasound image producer which produces an ultrasound image from reception data based on a predetermined set sound speed, a reception data image producer which produces a reception data image representing a luminance image of an ultrasonic echo wavefront from the reception data corresponding to a predetermined range on at least one scan line in the ultrasound image, a sound speed determination unit configured to determine an optimum sound speed based on ultrasound images respectively produced by the ultrasound image producer while changing the predetermined set sound speed, and a controller which makes an ultrasound image for diagnosis produced by the ultrasound image producer and the reception data image produced by the reception data image producer be displayed simultaneously on a display unit based on the optimum sound speed determined by the sound speed determination unit.. . ... Fujifilm Corporation

01/22/15 / #20150025377

Radiographic imaging device and radiography protection unit

A radiographic imaging device comprising an imaging platform that includes an imaging surface on which a breast of a test subject is to be rested; a radiation irradiation section disposed to face the imaging surface and irradiates radiation at the imaging surface; a main radiation protection portion that is disposed at the side of a region between the radiation irradiation section and the imaging surface and that is adapted to protect the test subject from the radiation; and an auxiliary radiation protection portion disposed at a side portion of the main radiation protection portion, and that is movable between a protecting position, at which the auxiliary radiation protection portion is adapted to protect the test subject, and a non-protecting position, at which the auxiliary radiation protection portion is withdrawn from the protecting position.. . ... Fujifilm Corporation

01/22/15 / #20150024392

Method for producing a biosensor

An object of the present invention is to provide a biosensor comprising a hydrogel capable of immobilizing a physiologically active substance thereon, which can be produced conveniently by use of a safe material, and a method for producing the same. The present invention provides a method for producing a biosensor, which comprises bringing a polymer containing an activated carboxyl group into contact with a substrate surface coated with an organic layer having an amino group to thereby bind the polymer to the organic layer.. ... Fujifilm Corporation

01/22/15 / #20150024325

Lithographic printing original plate

A presensitized plate having a long press life and excellent resistance to scum and corrosive micro-stains and capable of on-press development is provided. The presensitized plate includes a photosensitive layer containing (a) a sensitizing dye, (b) a polymerization initiator, (c) a polymerizable compound, and (d) a binder polymer; and a protective layer which are formed on a support in this order. ... Fujifilm Corporation

01/22/15 / #20150024226

Laminated body for polarizing plate, polarizing plate comprising the same and liquid crystal display device

An aspect of the present invention relates to a laminated body, which is a laminated body for a polarizing plate as well as comprises a polymer film and a layer comprising a sulfonyl group-containing compound, wherein either or both of the polymer film and the layer comprising a sulfonyl group-containing compound comprises an aromatic secondary amine.. . ... Fujifilm Corporation

01/22/15 / #20150022908

Imaging lens and imaging apparatus

An imaging lens substantially consists of a front-group consisting of a first lens having a negative meniscus shape with its convex surface facing an object side, a second lens having negative refractive power, a third lens having positive refractive power, a fourth lens having a negative meniscus shape with its concave surface facing an image side and a fifth lens having positive refractive power, and the front-group having positive refractive power as a whole, a stop, and a rear-group consisting of a sixth lens having positive refractive power and a seventh lens having a negative meniscus shape with its concave surface facing the object side, and the rear-group having positive refractive power as a whole, in this order from the object side. A predetermined conditional formula about a combined focal length of the first lens and the second lens, and a focal length of an entire system is satisfied.. ... Fujifilm Corporation

01/22/15 / #20150022905

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens substantially includes six lenses, constituted by: a first lens having a negative refractive power, which is of a meniscus shape having a concave surface toward an image side; a second lens; a third lens; a fourth lens; a fifth lens having a positive refractive power; and a sixth lens having a negative refractive power, a concave surface toward the image side, and at least one inflection point in the surface toward the image side; provided in this order from an object side. The imaging lens satisfies a predetermined conditional formula.. ... Fujifilm Corporation

01/22/15 / #20150022901

Zoom lens and imaging apparatus

A zoom-lens substantially consists of a positive-first-lens-group, fixed during magnification-change, a negative-second-lens-group, which moves from object-side toward image-side during magnification change from wide-angle-end to telephoto-end, a negative-third-lens-group, which corrects movement of an image-plane during magnification-change, and a positive-fourth-lens-group, which is fixed during magnification-change and includes a stop, in this order from object-side. The first-lens-group substantially consists of a negative-1a-th-lens-group, fixed during focusing, a positive-1b-th-lens-group, which moves during focusing, and a positive-1c-th-lens-group, fixed during focusing, in this order from object-side. ... Fujifilm Corporation

01/22/15 / #20150022871

Mirror drive device and driving method thereof

In a mirror drive device, a first actuator section and a second actuator section are arranged on both sides of a mirror supporting section that supports a mirror section so as to sandwich the mirror supporting section. The upper electrode of a first actuator section includes a first electrode section and a second electrode section, and an upper electrode of a second actuator section includes a third electrode section and a fourth electrode section. ... Fujifilm Corporation

01/22/15 / #20150022854

Data communication apparatus and method, and product producing system

Provided are a data communication apparatus and method and a product producing system which can prevent each user, which is a person in charge of a work item, from forgetting the content and existence of a notice. It is determined whether the re-notification of data for urging the execution of a work item corresponding to an execution phase (hereinafter, referred to as an execution target item) is required on the basis of progress information of each work item. ... Fujifilm Corporation

01/22/15 / #20150022764

Phase difference film, polarizing plate, and liquid crystal display device

There is provided a phase difference film which includes a, an intermediate layer, and a phase difference layer to which an alignment state of a liquid crystal material is fixed in this order, in which the substrate contains cellulose acylate in which an average substitution degree ds of an acyl group satisfies 2.0<ds<2.6, specific polycondensation ester, or specific sugar ester, the intermediate layer contains a polyvinyl alcohol resin or an acrylic resin having a polar group, and the phase difference layer contains a liquid crystal compound which is homeotropically aligned and has specific optical characteristics.. . ... Fujifilm Corporation

01/22/15 / #20150022748

Phase difference film, polarizing plate, liquid crystal display device, and method of producing phase difference film

There is provided a phase difference film which includes a substrate, an acrylic resin layer, an intermediate layer containing a main component of the substrate and a main component of the acrylic resin layer between the substrate and the acrylic resin layer, and a specific phase difference layer directly on a surface on the opposite side to the intermediate layer of the acrylic resin layer, in which the substrate contains at least one kind of resin selected from a cellulose acylate resin, a cyclic olefin resin, a polycarbonate resin, an acrylic resin, and a styrene resin, the acrylic resin layer contains an acrylic resin having a polar group, the intermediate layer has a thickness of 0.1 μm to 10 μm, and the phase difference layer is formed by polymerizing a polymerizable liquid crystal compound containing a vertical alignment agent.. . ... Fujifilm Corporation

01/22/15 / #20150022706

Imaging device, and imaging method

According to the preset invention, an optical viewfinder state in which an optical image of a photographic subject can be observed at an eyepiece part of a finder and an electronic viewfinder state in which a captured image of the photographic subject can be observed at the eyepiece part of the finder are switched when a first operation is carried out with a finger by an operation device, and a magnification (optical magnification) of a first finder optical system of the finder is changed when a second operation is carried out with a finger by the operation device in the optical viewfinder state. Thus, a user can perform photographing while freely observing the photographic subject by an operation of switching the finder (first operation) and an operation of changing the optical magnification of the finder (second operation) while looking through the finder.. ... Fujifilm Corporation

01/22/15 / #20150022694

Interchangeable-lens camera, and viewfinder display method

The information about an interchangeable lens is acquired, and the size of an image capture range, which is the range corresponding to a capture image in an optical image, is calculated based on the information about the interchangeable lens. When the image capture range is smaller than or equal to a range to be shown by the angular field of the optical image, a first image showing the image capture range in the optical image is displayed on a display device, and when the image capture range is larger than the range to be shown by the angular field of the optical image, a second image different from the first image showing the image capture range in the optical image is displayed on the display device such that the second image is superimposed on at least either of the four corner vicinities and four side vicinities of the optical image.. ... Fujifilm Corporation

01/15/15 / #20150019246

Medical care information display control apparatus, method, and program

. . . . . . . . . . Among a plurality of medical care information sets, each correlating a plurality of medical care items, medical care data of a display target patient corresponding to each medical care item, and a registration reference time of the medical care data, obtaining a plurality of medical care information sets whose registration reference times fall within the target period as target medical care information. Among a plurality of medical care item groups, each correlating a plurality of medical care items to be displayed on a display screen, extracting a medical care item group that includes a medical care item of interest which is a predetermined medical care item included in the target medical care information as a display item group, and displaying medical care data of the display target patient corresponding to the plurality of medical care items included in the extracted display item group.. ... Fujifilm Corporation

01/15/15 / #20150018688

Ultrasound probe and ultrasound diagnostic apparatus including same

The ultrasound probe includes ultrasound transducers arranged in an array; transmission paths of the reception signals; impedance matching elements connected to the ultrasound transducers, respectively, each being disposed in each of the transmission paths of the reception signals, and each having a respective preset matching frequency. The impedance matching elements have a distribution in which a matching frequency of an impedance matching element becomes higher as an arrangement position of an ultrasound transducer corresponding to the impedance matching element in the array of the ultrasound transducers becomes closer to a center of the array, in order to reduce an influence of transmission/reception angles of ultrasonic waves due to the arrangement position of the corresponding ultrasound transducer in the array.. ... Fujifilm Corporation

01/15/15 / #20150018687

Ultrasound probe and connection method for signal lines

An ultrasound probe includes a plurality of piezoelectric elements arranged in an array, a plurality of drawn-out signal lines drawn out from the plurality of piezoelectric elements, and a print board on which a plurality of connection conductors are formed for connecting between a plurality of communication cables connected to an ultrasound diagnostic apparatus body and the plurality of drawn-out signal lines, respectively, connection-conductor insulation layers being formed on the printed board so as to cover respective outer peripheries of the plurality of connection conductors, and a connection-conductor ground conductive layer being formed on the printed board so as to cover individual outer peripheries of the connection-conductor insulation layers, whereby the plurality of connection conductors are shielded from one another.. . ... Fujifilm Corporation

01/15/15 / #20150018445

Semi-cured product, cured product and method of manufacturing same, optical component, curable resin composition

A curable resin composition comprising a (meth)acrylate monomer having an aromatic ring, a non-conjugated vinylidene group-containing compound represented by the general formula below, and a thermal or a photo-radical polymerization initiator makes it possible to produce a cured product with minimized occurrence of burring during molding and high product yield after molding. The cured product has good heat coloration resistance and low abbe's number. ... Fujifilm Corporation

01/15/15 / #20150017576

Pattern forming method, method for selecting heating temperature in pattern forming method, extreme ultraviolet-sensitive resin composition, resist film, manufacturing method of electronic device using the same, and electronic device

There is provided a pattern forming method comprising, in order: (i) a step of forming a film by using an extreme ultraviolet-sensitive resin composition containing (a) a resin having an acid-decomposable group; (ii) a step of exposing the film by using an extreme ultraviolet ray; (iii) a step of heating the film; and (iv) a step of developing the film to form a pattern, wherein in the step (ii), an optical image formed by exposure on the surface of the film is an optical image having a line part with a line width of 20 nm or less as an exposed area or an unexposed area, and, the heating temperature tpeb(° c.) in the step (iii) satisfies the specific formula.. . ... Fujifilm Corporation

01/15/15 / #20150017424

Heat ray shielding material and laminate structure

A heat ray shielding material having a metal particle-containing layer and a fine-particle containing overcoat layer disposed thereon wherein hexagonal to circular tabular metal particles are contained in 60% by number or more relative to total number of the metal particles contained in the metal particle-containing layer, a main plane of the hexagonal to circular, tabular metal particles is plane-oriented in a range of from 0° to ±30° on average relative to one surface of the metal particle-containing layer, exhibits favorable adhesion-failure resistance, scratch resistance and low haze.. . ... Fujifilm Corporation

01/15/15 / #20150017423

Method for producing laminate film containing liquid crystalline compound having high crystallinity

The present invention provides a method for producing a laminate film comprising forming a layer by curing a liquid crystalline composition containing a liquid crystalline compound that has a polymerizable group and is solid at 25° c. And forming, on the layer, a polymer layer from a composition containing a polymer, the liquid crystalline compound migrating into the polymer layer after forming the polymer layer until the compound becomes 0.1% by mass to 30% by mass relative to the solid content mass of the polymer layer, wherein the method includes selecting the liquid crystalline compound and the polymer from combinations having a heat of crystallization of a mixture obtained by mixing the two at a mass ratio of 9:10, of 0.75 j/g or less. ... Fujifilm Corporation

01/15/15 / #20150017347

Method for producing film with coating

Even in the case where a coating liquid is applied onto an inorganic vapor-deposited film deposited on a support in advance, it is possible to effectively prevent cissing with a simple configuration and no increase in thickness of a product. A coating liquid preparation apparatus for preparing a coating liquid containing an actinic ray curable component, a coating apparatus for applying the coating liquid onto an inorganic vapor-deposited film deposited on a belt-like support in advance to form a coating, a first irradiation apparatus for irradiating the coating with an actinic ray, and a drying apparatus for drying the coating irradiated are provided in this order, and in the first irradiation apparatus, irradiation with an actinic ray is made in a state where the coating is wet, to place the curing rate of the curable component in the coating in a range of 10 to 80%.. ... Fujifilm Corporation

01/15/15 / #20150017339

Substrate structure grown by plasma deposition

Substrate structure comprising a substrate (6) and a plasma grown layer (6a). The surface of the resulting substrate structure (7) is characterized by interrelated scaling components. ... Fujifilm Corporation

01/15/15 / #20150016686

Image processing apparatus, method, and program

An image processing apparatus, including a filtering unit that performs filtering on an image using a second order partial differential and calculates a hessian matrix and an evaluation unit that discriminates a structure included in the image using eigenvalues and eigenvectors of the hessian matrix, in which the filtering unit includes a correction unit that performs filtering on the image using a first order partial differential of a function representing a hollow sphere having the same radius as the radius of the solid sphere and obtains first order partial differential vectors, and carries out correction to cancel out one of response waveforms of the function representing the solid sphere in each direction, the response waveforms appearing at two positions symmetrically separated with respect to the center of the solid sphere, using values obtained by projecting the first order partial differential vectors onto directions of the eigenvectors.. . ... Fujifilm Corporation

01/15/15 / #20150015980

Conductive film, display device equipped with same, and method for determining pattern of conductive film

This conductive film has a randomized wiring pattern having randomized rhomboid shapes obtained by giving irregularity in a predetermined range to rhomboid shapes of a rhomboidal wiring pattern which, with respect to frequencies of moire and intensities of moire obtained by applying a visual response characteristic of human beings to frequency information of moire and intensity information of moire calculated from peak frequencies and peak intensities in both two-dimensional fourier spectra of transmittance image data of the wiring pattern and transmittance image data of the pixel array pattern, causes a sum of intensities of moire each corresponding to each of frequencies of moire falling within a predetermined frequency range determined depending on the visual response characteristic to be less than or equal to a predetermined value. The conductive film allows suppression of moire and significant improvement in visibility.. ... Fujifilm Corporation

01/15/15 / #20150015979

Conductive film, display device equipped with same, and method for determining pattern of conductive film

The conductive film has a wiring pattern which, with respect to the frequencies and intensities of moire obtained by applying a human visual response characteristic to the frequency information and intensity information of moire calculated from peak frequencies and peak intensities of the two-dimensional fourier spectrums of the transmittance image data of the wiring pattern and the transmittance image data of a pixel array pattern, causes the sum of intensities of moire each corresponding to frequencies of moire falling within a frequency range predetermined depending on the visual response characteristic to be less than or equal to a predetermined value. The conductive film allows suppression of moire and significant improvement in visibility.. ... Fujifilm Corporation

01/15/15 / #20150015973

Compound lens and method for manufacturing same

A compound lens produced by heating and pressing a semi-cured product of a curable resin composition containing a (meth)acrylate monomer, a non-conjugated vinylidene group-containing compound, and a photo-radical initiator and a transparent substrate arranged so as to be in contact with the semi-cured product in a state in which a molding die is filled with the semi-cured product and the transparent substrate, and obtaining a cured product by allowing the semi-cured product to be thermally polymerized, exhibits an excellent transfer property, a small number of bubble mixtures, and excellent heat resistance and crack resistance.. . ... Fujifilm Corporation

01/15/15 / #20150015949

Film and method for manufacturing the same, optical film, polarizer-protecting film, polarizing plate, and image display device

Disclosed is a film having a cyclic olefin resin layer including a cyclic olefin resin and a cage-shaped silosesquioxane compound wherein the cage-shaped silosesquioxane compound includes at least one substituent having one or more carbon atoms as a substituent of a si atom. The film has a cyclic olefin resin layer with a high water vapor barrier property, low haze, and high surface hardness.. ... Fujifilm Corporation

01/15/15 / #20150015833

Cellulose acylate film and method for producing the same

A cellulose acylate film that contains at least one kind of cellulose acylate that has a substitution degree of an acyl group that contains an aromatic group of from 0.1 to 2.0, or a substitution degree of an acyl group having from 2 to 4 carbon atoms of from 2.0 to 2.6, and has an in-plane retardation at a wavelength of 550 nm re(550) of from 80 to 350 nm, and the number of bright spots caused from irregular retardation regions having a major axis diameter of from 0.01 to 0.05 mm of 500 or less per 1 cm2 causes less light leakage irrespective of re of 80 nm or more, so as to enhance the display capability of ips type and ffs type liquid crystal display devices.. . ... Fujifilm Corporation

01/15/15 / #20150015832

Optical film, polarizing plate, and liquid crystal display device

Disclosed is an optical film having a cellulose ester and a polyester containing an alicyclic structure and having a hydroxyl terminal group, a hydrogen atom of which is substituted by an acyl group derived from a monocarboxylic acid, and having a thickness of from 10 to 45 μm, an in-plane retardation of from −5 to 5 nm, a retardation in thickness direction of from −5 to 5 nm, and an elastic modulus of 4.2 gpa or more. The optical film has a reduced thickness, achieves both a high rigidity and optical characteristics including a low retardation, and enhances the polarizer durability used in a polarizing plate.. ... Fujifilm Corporation

01/15/15 / #20150015815

Stereoscopic image display device and stereoscopic image display system

A stereo picture display apparatus with decreased cross talk without a decrease in an aperture ratio, includes a picture displaying panel and a patterned retardation plate disposed on a viewer side of a picture displaying panel which includes left eye pixels and right eye pixels which are alternatively disposed at an integer of 2 or more, and black matrices; the patterned retardation plate includes a support and a patterned optically anisotropic layer thereon, having a first and second retardation region, and a boundary, the first and second retardation regions being alternately disposed at a predetermined pitch width in stripe pattern. The first and second retardation regions are different in at least one of an in-plane slow axis direction and a retardation from each other. ... Fujifilm Corporation

01/15/15 / #20150015813

Black resin film, capacitance type input device, method for producing them, and image display apparatus using the same

A black resin film is produced by applying a photosensitive resin composition containing a black pigment, an alkali-soluble polymer compound, an ethylenic unsaturated bond-containing compound and α-aminoalkylphenone or α-hydroxyalkylphenone as a photopolymerization initiator, to a substrate; and subjecting the composition to exposure, development and post-exposure. The post-exposure is performed from both side with 1,300 mj/cm2 or more in terms of i line.. ... Fujifilm Corporation

01/15/15 / #20150015768

Imaging element and imaging device

An imaging element includes: a semiconductor substrate in which a plurality of pixels is arranged in a two-dimensional array; a color filter layer which is laminated in a position corresponding to the pixel on an upper layer of the semiconductor substrate; a plurality of micro lenses which is laminated on an upper layer of the color filter layer to condense light which is incident onto the pixel; and an isolated columnar reflective wall which is vertically provided in an intermediate layer between the semiconductor substrate and the micro lens at every position of a gap enclosed by the plurality of adjacent micro lenses and reflects the light which is incident onto the color filter from the gap to a direction facing the pixel corresponding to the color filter.. . ... Fujifilm Corporation

01/15/15 / #20150015677

Image processing device and method, and imaging device

An image processing method according to the present invention acquires a first image and second image that are picked up through a single image-taking optical system, that are images after a pupil division, and that have a parallax to each other, and then performs a filtering process for each pixel of the first and second images, using first and second transform filters that correspond to the parallax for the pixel and that are of first and second transform filter groups to be respectively applied to the first and second images for the transform into third and fourth images in which the parallax amount and blur amount of the first and second images have been altered.. . ... Fujifilm Corporation

01/15/15 / #20150015672

Image processing device, imaging device, image processing method, and recording medium

An image processing method according to the present invention cuts out partial images corresponding to trimming regions, which is specified for multiple viewpoint images of a stereoscopic image obtained by pupil-division-scheme imaging, from the respective viewpoint images, generates a stereoscopic partial image including multiple partial images, generates parallax information that indicates the parallax between the partial images, adjusts the parallax between the partial images based on the parallax information, and then, for the partial images after the parallax adjustment, enhances the sharpness as the adjusted parallax amount decreases and reduces the sharpness as the adjusted parallax amount increases.. . ... Fujifilm Corporation

01/15/15 / #20150015639

Inkjet ink set and image forming method

An inkjet ink set including: an ink composition including water, a colorant, polymer particles having a glass transition temperature of 90° c. Or higher, an organic amine and an inorganic salt; and a treatment liquid that includes an acidic compound and generates aggregation when comes into contact with the ink composition. ... Fujifilm Corporation

01/15/15 / #20150014894

Curable composition for imprints, cured product and method for manufacturing a cured product

Provided is a curable composition for imprints having good patternability and dry etching resistance. Disclosed is a curable composition for imprints comprising a polymerizable monomer (ax) having a substituent having an aromatic group and having a molecular weight of 100 or more, and a photopolymerization initiator.. ... Fujifilm Corporation

01/15/15 / #20150014819

Underlying film composition for imprints and pattern forming method using the same

Provided is an underlying film composition for imprints showing a good adhesiveness with a base and capable of reducing failure or defect of resist pattern. The underlying film composition for imprints comprising a curable main component and a urea-based crosslinking agent.. ... Fujifilm Corporation

01/15/15 / #20150014030

Composition for forming silver ion diffusion-suppressing layer, film for silver ion diffusion-suppressing layer, circuit board, electronic device, conductive film laminate, and touch panel

A composition for forming a silver ion diffusion-suppressing layer includes an insulating resin and a compound including: a structure selected from the group consisting of a triazole structure, a thiadiazole structure and a benzimidazole structure; a mercapto group; and at least one hydrocarbon group optionally containing a heteroatom, with the total number of carbon atoms in the hydrocarbon group or groups being 5 or more. The composition for forming a silver ion diffusion-suppressing layer allows formation of a silver ion diffusion-suppressing layer capable of suppressing silver ion migration between metal interconnects containing silver or a silver alloy to improve the reliability on the insulation between the metal interconnects.. ... Fujifilm Corporation

01/15/15 / #20150013764

Conductive composition, conductive member, conductive member production method, touch panel, and solar cell

The conductive composition contains at least (a) conductive metal fibers, and (b) at least one compound selected from a compound represented by the following formula (1), a compound represented by the following formula (2), and a compound having a partial structure represented by the following formula (3). Each of r1 and r2 independently represents a hydrogen atom, an alkyl group, an alkenyl group, an aryl group, an acyl group, an aryloxycarbonyl group, an alkoxycarbonyl group, or a carbamoyl group. ... Fujifilm Corporation

01/15/15 / #20150013763

Conductive composition, conductive member, conductive member production method, touch panel, and solar cell

The conductive composition contains at least (a) conductive metal fibers, and (b) at least one compound selected from a compound represented by the following formula (1) and a compound represented by the following formula (2). In formula (1), each of r1 and r2 independently represents an alkyl group, an aryl group, an alkoxy group, an aryloxy group, or a halogen atom, and r3 represents an alkyl group or an aryl group. ... Fujifilm Corporation

01/08/15 / #20150011499

Salt of 1-(2-deoxy-2-fluoro-4-thio-beta-d-arabinofuranosyl)cytosine

. . . . . . A superior antitumor agent is provided. A salt of 1-(2-deoxy-2-fluoro-4-thio-β-d-arabinofuranosyl)cytosine shows at least one or more of such characteristics as (1) it has superior antitumor activity, (2) it shows superior crystallinity, (3) it shows high water solubility, (4) it does not show deliquescent property, (5) it shows superior flowability, (6) it shows superior tableting property, (7) it can be manufactured with less environmental load, and (8) it can be manufactured in a large scale, and therefore it is useful as a bulk drug for medicaments.. ... Fujifilm Corporation

01/08/15 / #20150010858

Pattern forming method, actinic ray-sensitive or radiation-sensitive composition used therein, resist film, manufacturing method of electronic device using the same, and electronic device

There is provided a pattern forming method comprising (i) a step of forming a film by using an actinic ray-sensitive or radiation-sensitive composition containing (a) a non-polymeric acid-decomposable compound having an aromatic ring and a molecular weight of 500 to 5,000 and (b) a compound capable of generating an acid upon irradiation with an actinic ray or radiation; (ii) a step of exposing the film, and (iii) a step of performing development by using an organic solvent-containing developer to form a negative pattern.. . ... Fujifilm Corporation

01/08/15 / #20150010857

Actinic ray-sensitive or radiation-sensitive composition, resist film using the same, pattern forming method, method for manufacturing electronic device, and electronic device

There is provided an actinic ray-sensitive or radiation-sensitive resin composition containing a resin (p) having a repeating unit represented by the following formula (a) and having at least two of a repeating unit represented by the following formula (b), a repeating unit represented by the following formula (c), a repeating unit represented by the following formula (d) and a repeating unit represented by the following formula (e).. . ... Fujifilm Corporation

01/08/15 / #20150010856

Colored radiation-sensitive composition, colored cured film, color filter, colored pattern forming method, color filter production method, solid-state image sensor, and image display device

Colored radiation-sensitive composition includes (a) a dye multimer, (b) an alkali-soluble resin containing at least one kind of repeating unit selected from a group consisting of a repeating unit represented by the following formula (b1) and a repeating unit represented by the following formula (b2), (c) a polymerizable compound, and (d) a photopolymerization initiator. In the formulae, each of r1 and r4 independently represents a hydrogen atom, an aryl group, or an alkyl group, and among these, an aryl group is preferable. ... Fujifilm Corporation

01/08/15 / #20150010761

Cholesteric liquid crystal mixture, film, ir reflection plate, laminate, and laminated glass

A cholesteric liquid crystal mixture containing a compound represented by z1-y1-a1-y3-m1-y4-a2-y2-z2, a compound represented by z3-y5-a3-y7-m2-p, and a tri- or higher functional polymerizable monomer suppresses deposition of a liquid crystal at the time of forming a film, exhibits a wide characteristic reflection bandwidth of the film. Z1 to z3 represent a polymerizable group; a1 to a3 represent an alkylene spacer having a chain of 1 to 30 atoms; m1 and m2 represent (-t1-y8)n-t2-; n indicates a natural number; t1 and t2 represent a hydrocarbon or heterocyclic ring; y1 to y5, y7 and y8 represent a single bond, —o—, —co—, —o—co—, —co—o— or —o—co—o—; and p represents a hydrogen atom or an alkyl group.. ... Fujifilm Corporation

01/08/15 / #20150010698

Method of manufacturing hexagonal ferrite magnetic particles

The method of manufacturing hexagonal ferrite magnetic particles comprises applying an adhering matter comprising a glass component and an alkaline earth metal to hexagonal ferrite magnetic particles, and subjecting the hexagonal ferrite magnetic particles to which the adhering matter has been applied to a heat treatment.. . ... Fujifilm Corporation

01/08/15 / #20150010466

Method of manufacturing hexagonal ferrite magnetic particles

The method of manufacturing hexagonal ferrite magnetic particles comprises applying, in a water-based solution, an adhering matter comprising a glass component and an alkaline earth metal to iron oxide particles to which a surfactant adheres, and calcining the iron oxide particles to which the adhering matter adheres to obtain a calcined product in which a main component that is detected by x-ray diffraction analysis is hexagonal ferrite.. . ... Fujifilm Corporation

01/08/15 / #20150010247

Image processing device, imaging device, computer-readable storage medium, and image processing method

A transformed image, that is transformed by making a position of an image of a same subject correspond to a reference image, is generated for a non-reference image, and noise reduction is carried out on the reference image so as to generate a noise reduced image, and a weighting coefficient of the reference image with respect to the transformed image is set, and combining processing of the reference image and the transformed image is carried out so as to generate an intermediate composite image, and a weighting coefficient of the noise reduced image with respect to the intermediate composite image is set and combining processing of the intermediate composite image and the noise reduced image is carried out so as to generate a final image.. . ... Fujifilm Corporation

01/08/15 / #20150010130

Radiation image detection device and radiation imaging system

A radiation imaging system comprises a radiation source and a radiation image detection device. The radiation image detection device has a solid state detector and a wavelength converting layer arranged in this order from a radiation-incident side. ... Fujifilm Corporation

01/08/15 / #20150010030

Cooling system, reservoir unit and cartridge, as well as solid-state laser oscillator system provided with the same

A reservoir unit which is included as an element along a circulation path of a cooling system includes a cartridge and a cartridge loading unit which are configured to be removable from each other. The cartridge includes a reservoir chamber that stores a circulating liquid, and a connection portion in fluid communication with the reservoir chamber. ... Fujifilm Corporation

01/08/15 / #20150009578

Imaging lens and imaging apparatus equipped with the imaging lens

An imaging lens substantially includes seven lenses, constituted by: a first lens having a positive refractive power and a convex surface toward an image side; a second lens having a negative refractive power; a third lens having a positive refractive power; a fourth lens; a fifth lens having a positive refractive power; a sixth lens; and a seventh lens having a negative refractive power, a concave surface toward an image side, and at least one inflection point in the surface toward the image side; provided in this order from an object side. All of the first lens through the seventh lens are single lenses.. ... Fujifilm Corporation

01/08/15 / #20150009458

Polarizer and liquid-crystal display device

A polarizer having at least one optical film and at least one polarizing film, wherein the absolute value of the photo-elastic coefficient c of the optical film is 2×10−12 pa−1 or more, the optical film has an in-plane direction in which the sound propagation velocity is the maximum, and the angle between the in-plane direction in which the sound propagation velocity through the optical film is the maximum and the direction of the absorption axis of the polarizing film falls within a range of from 0° to less than 45°, is excellent in working aptitude and can prevent optical unevenness of the liquid-crystal display device accompanied by environmental changes.. . ... Fujifilm Corporation

01/08/15 / #20150009395

Imaging device

An imaging device according to one mode of the present invention includes a taking lens formed of two or more physically separated lenses and having a plurality of regions each having an individual focal distance corresponding to a combination of the two more lenses, an image pickup element having a plurality of light-receiving sensors provided to correspond to the plurality of regions, the plurality of light-receiving sensors each selectively receiving a light beam passing through any of the plurality of regions, and an image generating unit which generates an image of a subject from an imaging signal outputted from the image pickup element.. . ... Fujifilm Corporation

01/08/15 / #20150009393

Imaging apparatus and photographing support method

A digital camera 10 includes an imaging device 21a, a finder device 15, a phase difference information analyzing portion 71 and a control portion 32. In the finder device 15, an image in which an ovf optical image formed by an objective optical system 65 and an image displayed on a display portion 61 are superimposed on each other can be observed through an eyepiece window 17. ... Fujifilm Corporation

01/08/15 / #20150009373

Imaging element and imaging apparatus

A solid-state imaging element includes pixel cells in which apertures of light shielding films are off-centered in opposite directions. The pixel cells includes a pixel cell which detects a r light component, a pixel cell which detects a g light component, and a pixel cell which detects a b light component. ... Fujifilm Corporation

01/08/15 / #20150009369

Imaging device and imaging method

In an imaging method according to the present invention, in an imaging device including a taking lens having a plurality of regions each with an independent characteristic and an image pickup element having a plurality of light-receiving sensors provided so as to correspond to the plurality or regions, the plurality of light-receiving sensors performing pupil division of a light beam passing through any of the plurality of regions for selective light-receiving, from an imaging signal from a light-receiving sensor corresponding to one region of the plurality of regions, an image corresponding to the one region is generated. When the generated image is corrected, an influence of a light beam passing through a region other than the one region is removed from the image generated so as to correspond to the one region.. ... Fujifilm Corporation

01/08/15 / #20150009367

Image element, and imaging device and imaging method using the same

An imaging element which outputs a pair of image signals corresponding to a pair of luminous fluxes which pass through different pupil areas of a photographing optical system, the imaging element includes a first pixel cell group including a plurality of first pixel cells for obtaining the pair of image signals and a second pixel cell group including a plurality of second pixel cells for obtaining the pair of image signals. The first pixel cell includes a first photoelectric converting unit and a first micro lens which is provided above the first photoelectric converting unit. ... Fujifilm Corporation

01/08/15 / #20150009311

Endoscope image recording apparatus, endoscope image acquisition assisting method and computer readable medium

Plural predetermined examination parts of a patient are imaged sequentially and still images of the respective examination parts are thereby acquired by inserting an endoscope insertion unit having an imaging optical system in its tip portion into the body cavity of the patient. To this end, the number of still images taken is counted every time one of the predetermined examination parts. ... Fujifilm Corporation

01/08/15 / #20150009310

Endoscope system and method for operating the same

A v-led emits violet narrowband light. A g-led emits green light. ... Fujifilm Corporation

01/08/15 / #20150009299

Image processing device, imaging device, and image processing method

The present invention includes an image acquisition device configured to acquiring multiple viewpoint images that are generated by pupil-division imaging and that are different in viewpoint, a parallax calculation device 40a for calculating a first parallax amount between viewpoint images for the multiple viewpoint images, a memory 48 in which parallax correction information indicating the relationship between the first parallax amount and the deviation amount in the parallax direction for the corresponding object images, which is a deviation amount between viewpoint images for the multiple viewpoint images and is caused by the pupil-division imaging, is stored, and a parallax correction device 40b for calculating a second parallax amount, which is an amount resulting from correcting the first parallax amount to the deviation amount in the parallax direction for the object images, based on the first parallax amount and the parallax correction information stored in the memory 48.. . ... Fujifilm Corporation

01/08/15 / #20150009294

Image processing device and method, and imaging device

An image processing device comprising: an image acquisition device; a parallax information acquisition device; and a calculation device configured to calculate a first pixel and a second pixel for each pixel of the acquired image, the first digital filter and the second digital filter corresponding to the parallax information for each pixel of the acquired image, the first digital filter group and the second digital filter group being digital filter groups for giving a parallax to the acquired image and having left-right symmetry to each other, and each of the first digital filter group and the second digital filter group having filter sizes that are different depending on a magnitude of the parallax to be given, wherein the left-right symmetry of the first and second digital filter groups is different between a central part and an edge part of the image.. . ... Fujifilm Corporation

01/08/15 / #20150009246

Image display device and method

An image display method includes the steps of: acquiring a third image formed by applying dynamic range extension processing to a first image and a second image photographed with low sensitivity or low exposure with respect to the first image, or a fourth image without dynamic range extension processing; displaying the acquired image in a transmissive type display panel; and making backlight luminance of a segment corresponding to a high luminance portion in the third image higher than backlight luminance of a segment corresponding to a low luminance portion when the acquired image is determined to be the third image.. . ... Fujifilm Corporation

01/08/15 / #20150008211

Method for developing resist, method for forming a resist pattern, method for producing a mold, and developing fluid utilized in these methods

A method for developing a non chemically amplified resist employs a developing fluid having a carboxylic acid compound, which is a carboxylic acid ester having branched chain alkyl groups and a total carbon number of 8 or greater, as a main component. It is particularly preferable for the carboxylic acid compound to be at least one of isobutyl butyrate, butyl isobutyrate, isobutyl isobutyrate, isoamyl isobutyrate, and 2-methylbutyrate 2-methylbutyl. ... Fujifilm Corporation

01/08/15 / #20150007886

Polymer sheet, back protective sheet for solar cell, and solar cell module

Surface shape defects in a polymer sheet having a visual transmittance of from 5% to 50% and a visual absorption of from 10% to 50% are easily recognized.. . ... Fujifilm Corporation

01/08/15 / #20150007885

Polyester film and method for producing the same, back sheet for solar cell, and solar cell module

A polyester film containing a polyester support having a terminal carboxylic acid value of from 3 to 20 eq/ton and iv of from 0.65 to 0.9 dl/g, and a conductive layer having a surface specific resistance of from 106 to 1014Ω per square with an in-plane distribution of from 0.1 to 20% exhibits an improvement in withstand voltage.. . ... Fujifilm Corporation

01/01/15 / #20150005659

Image analysis apparatus, method, and program

. . The region extraction unit extracts lung regions from three-dimensional images of a plurality of time phases, the alignment unit aligns pixel position in the lung region extracted from each three-dimensional image between the three-dimensional images. This calculates a displacement vector field at each time phase of the three-dimensional images. ... Fujifilm Corporation

01/01/15 / #20150004695

Lipid particle, nucleic acid transfer carrier, compound for manufacturing nucleic acid transfer carrier, method for manufacturing lipid particle, and gene transfer method

The present invention provides a lipid particle which has low cytotoxicity, can stably hold a nucleic acid molecule outside a cell (in blood), and can escape from an endosome and rapidly release the nucleic acid in the cytoplasm; a nucleic acid transfer carrier; a compound for manufacturing a nucleic acid transfer carrier; a method for manufacturing a lipid particle; and a gene transfer method. The lipid particle contains, as constituents, a phospholipid having one or more amino groups and one or more nitrogen-containing heterocyclic groups, a neutral lipid not containing a nitrogen-containing heterocyclic group, a sterol, and a nucleic acid.. ... Fujifilm Corporation

01/01/15 / #20150004327

Conductive member and method for manufacturing same

A conductive member includes a substrate, conductive layers that are provided on both surfaces of the substrate, and contain a conductive fiber having an average minor axis length of 150 nm or less and a matrix, and intermediate layers that are provided between the substrate and the conductive layers, and contain a compound having a functional group capable of interacting with the conductive fiber, and, when surface resistance values of the two conductive layers are represented by a and b respectively, and an a value is equal to or greater than a b value, a/b is in a range of 1.0 to 1.2.. . ... Fujifilm Corporation

01/01/15 / #20150003710

Image processing device, method and non-transitory storage medium

At least one of the common regions in time-sequence images is specified. Then, the time-sequence images are adjusted such that the position of that common region in at least one image among the time-sequence images is adjusted to the position of that common region in a different image. ... Fujifilm Corporation

01/01/15 / #20150002946

Imaging lens and imaging apparatus

An imaging lens substantially consisting of a first lens group, a stop, and a second lens group in this order from the object side, the first lens group includes at least a positive lens, a negative meniscus lens with a convex surface toward the object side, a biconcave negative lens, and a cemented lens substantially constituted by two lenses, which are a positive lens and a negative lens, in this order from the object side; the second lens group includes at least a first positive lens with a convex surface toward the image side, a cemented lens substantially constituted by two lenses, which are a positive lens and a negative lens, and a second positive lens with a convex surface toward the image side, in this order from the object side; and a predetermined conditional expression is satisfied.. . ... Fujifilm Corporation

01/01/15 / #20150002943

Variable magnification optical system and imaging apparatus

In a variable magnification optical system, including a first lens group having a positive refractive power, a second lens group having a negative refractive power, a third lens group having a positive refractive power, and a fourth lens group having a positive refractive power, arranged in order from the object side, in which magnification is changed by moving the second lens group and focusing is performed by moving the fourth lens group, the first lens group includes a positive lens and a positive cemented lens, arranged in order from the object side, the third lens group includes an aperture stop on the most object side, the fourth lens group includes a positive lens, a negative lens, and a positive lens, arranged in order from the object side, with at least one surface being an aspherical surface, and the system satisfies given conditional expressions.. . ... Fujifilm Corporation

01/01/15 / #20150002928

Infrared ray shielding film

An infrared ray shielding film having a metal particle-containing layer in which hexagonal to circular tabular metal particles are contained in 60% by number or more relative to total number of the metal particles contained in the metal particle-containing layer exhibits excellent infrared ray reflection at a wide range of from 800 nm to 2000 nm and shows little heat ray absorption.. . ... Fujifilm Corporation

01/01/15 / #20150002907

Image recording method and apparatus, and recording medium

The present invention provides an image recording method and apparatus and a recording medium therefor. In an aspect of the present invention, when recording the image in a condition where an image recording range in a first direction by the image recorder is a specific range, image processing is applied to the image data using a latest image processing parameter among image processing parameters which are according to positions in the first direction and have been generated on the basis of measurement results of test charts output using the specific range or a wider range than the specific range on the image recorder, and the image recorder is caused to record the image on the recording medium according to the image data after the image processing.. ... Fujifilm Corporation

01/01/15 / #20150002789

Optically-compensatory film, polarizing plate, liquid crystal display, and method of producing optically-compensatory film

To provide an optically-compensatory film that can improve the contrast, to provide a polarizing plate and a liquid crystal display including the optically-compensatory film and a method of producing the optically-compensatory film. An optically-compensatory film including a transparent support; and at least one optically anisotropic layer including a liquid crystal composition containing liquid crystal compounds, in the transparent support; wherein when the optically-compensatory film is disposed between two polarizing plates in a cross nicol state, degree of depolarization as seen from the front face is 0.000022 or less, and degree of depolarization as seen from a polar angle of 50° from an absorption axis direction of one of the polarizing plates is 0.00077 or less.. ... Fujifilm Corporation

01/01/15 / #20150002700

Image display device, photography device, image display system and method

An image display device includes: a transmissive display panel; a backlight unit on a back face thereof and performing backlight local dimming; a tag information analysis unit that analyzes tag information on an acquired image file; and a backlight control signal creation unit that detects luminance for each of divided image areas of an image in the image file to determine backlight luminance for each of divided light emission areas of the backlight unit in accordance with the detected luminance for each of the image areas in a case where it is determined to perform the bld in accordance with an analysis result of the tag information on the image file acquired by the tag information analysis unit, and that controls backlight luminance so that the backlight luminance of all the image in the image file becomes uniform in a case where it is determined not to perform the bld.. . ... Fujifilm Corporation

01/01/15 / #20150002635

Solid-state imaging device, imaging apparatus, and driving method of a solid-state imaging device

A solid-state imaging device 5 is equipped with sets of pixel cells 53(1)-53(4), each set assuming a bayer arrangement. A g pixel cell 53(2) is located right-adjacent to a g pixel cell 53(1). ... Fujifilm Corporation

01/01/15 / #20150002633

Imaging apparatus having projector and control method thereof

An imaging apparatus having a projector, includes: an imaging unit that photographs a subject; a mirror image converting unit that converts a live view image photographed by the imaging unit into a mirror image; a projector that projects the mirror image of the live view image in a direction opposite to a photographing direction of the imaging unit; a control unit that initiates actual photography for recording the subject by the imaging unit when a posture of a main subject satisfies a predetermined condition; and a pose image superimposing unit that superimpose a pose image on a projected image, in which the control unit determines that the predetermined condition is satisfied and performs the actual photography when a superimposition degree of the main subject in the projected image and the pose image is a threshold value or more.. . ... Fujifilm Corporation