Real Time Touch



new TOP 200 Companies filing patents this week

new Companies with the Most Patent Filings (2010+)




Real Time Touch

Fujifilm Corporation patents (2017 archive)


Recent patent applications related to Fujifilm Corporation. Fujifilm Corporation is listed as an Agent/Assignee. Note: Fujifilm Corporation may have other listings under different names/spellings. We're not affiliated with Fujifilm Corporation, we're just tracking patents.

ARCHIVE: New 2018 2017 2016 2015 2014 2013 2012 2011 2010 2009 | Company Directory "F" | Fujifilm Corporation-related inventors


Radiation irradiation device

. . . . Provided is a radiation irradiation device that can improve the degree of freedom of an arm part and can reduce the number of noise suppression components, such as a ferrite core. A radiation irradiation device includes a radiation generating part having a radiation source that generates radiation; an arm part having the radiation generating part attached to one end thereof; and a main body part having the other end of the arm part connected thereto. ... Fujifilm Corporation

Imaging device, and image processing method and program for imaging device

Image data obtained by imaging of an imaging element capable of imaging a subject with sensitivity to a wavelength band of visible light and a wavelength band of near-infrared light via an optical system is acquired. A point image restoration process using a common restoration filter is performed on the image data of the subject captured with sensitivity to the wavelength band of the visible light by the imaging element and the image data of the subject captured with sensitivity to the wavelength band of the near-infrared light by the imaging element. ... Fujifilm Corporation

Polymer composite piezoelectric body, electroacoustic transduction film, and electroacoustic transducer

Provided are a polymer composite piezoelectric body in which the conversion efficiency between electricity and sound is increased and thus the sound pressure level is improved, an electroacoustic transduction film, and an electroacoustic transducer. The polymer composite piezoelectric body includes a viscoelastic matrix formed of a polymer material having a cyanoethyl group, piezoelectric body particles which are dispersed in the viscoelastic matrix and have an average particle diameter of more than or equal to 2.5 μm, and dielectric particles dispersed in the viscoelastic matrix, in which the dielectric particles are formed of a material different from that of the piezoelectric body particles and have an average particle diameter of less than or equal to 0.5 μm and a relative permittivity of more than or equal to 80.. ... Fujifilm Corporation

Electronic circuit device and method for manufacturing electronic circuit device

An electronic circuit device includes a plurality of logic circuit elements which output an output signal by performing a preset operation on an input signal. Transistors constituting the logic circuit elements each have a gate electrode provided on a substrate, an insulating layer electrically insulating the gate electrode, a source electrode, a drain electrode, and a semiconductor layer. ... Fujifilm Corporation

Photoelectric conversion element, solar cell, and method for manufacturing photoelectric conversion element

Provided are a photoelectric conversion element including a first electrode having a photosensitive layer including a light absorber on a conductive support and a second electrode facing the first electrode, in which the light absorber includes a compound having a perovskite-type crystal structure, and a compound represented by a specific formula is provided on a surface of the first electrode, a solar cell using the same, and a method for manufacturing a photoelectric conversion element including bringing a first electrode having a photosensitive layer in which a compound having a specific perovskite-type crystal structure is included as a light absorber on a conductive support into contact with a liquid containing a compound represented by specific formula (ac).. . ... Fujifilm Corporation

Conductive film, method of producing the same, and touch panel

The conductive film is arranged on the support and contains a binder and a metal portion, in which a position at which the contour line reaches the metal portion included in the thin conductive wire is set as an upper end position, and an average area ratio va of the metal portion in a region ranging from the upper end position to 100 nm toward the support side is 1% or more and less than 50%, and a position at which the contour line reaches the thin conductive wire does not include the metal portion is set to a lower end position, and an average area ratio vm1 of the metal portion in a region ranging from a middle position between the upper end position and the lower end position to 50 nm toward the support side and to 50 nm toward the surface x side is 50% or more.. . ... Fujifilm Corporation

Magnetic tape and magnetic tape device

Provided is a magnetic tape in which the total thickness of a non-magnetic layer and a magnetic layer is equal to or smaller than 0.60 μm, the magnetic layer includes a timing-based servo pattern, the magnetic layer includes fatty acid ester, a full width at half maximum of spacing distribution measured by optical interferometry regarding the surface of the magnetic layer before performing vacuum heating with respect to the magnetic tape is greater than 0 nm and equal to or smaller than 7.0 nm, a full width at half maximum of spacing distribution measured after performing the vacuum heating is greater than 0 nm and equal to or smaller than 7.0 nm, and a difference between a spacing measured after performing the vacuum heating and a spacing measured before performing the vacuum heating is greater than 0 nm and equal to or smaller than 8.0 nm.. . ... Fujifilm Corporation

Magnetic tape and magnetic tape device

The magnetic tape includes a non-magnetic layer including non-magnetic powder and a binder on a non-magnetic support; and a magnetic layer including ferromagnetic powder and a binder on the non-magnetic layer, the total thickness of the non-magnetic layer and the magnetic layer is equal to or smaller than 0.60 μm, the magnetic layer includes a timing-based servo pattern, one or more components selected from the group consisting of fatty acid and fatty acid amide are at least included in the magnetic layer, and a c—h derived c concentration calculated from a c—h peak area ratio of c1s spectra obtained by x-ray photoelectron spectroscopic analysis performed on the surface of the magnetic layer at a photoelectron take-off angle of 10 degrees is equal to or greater than 45 atom %.. . ... Fujifilm Corporation

Magnetic tape and magnetic tape device

The magnetic tape includes a non-magnetic support; a non-magnetic layer including non-magnetic powder and a binder on the non-magnetic support; and a magnetic layer including ferromagnetic powder and a binder on the non-magnetic layer, in which the total thickness of the non-magnetic layer and the magnetic layer is equal to or smaller than 0.60 μm, the magnetic layer includes a timing-based servo pattern, the ferromagnetic powder is ferromagnetic hexagonal ferrite powder, the magnetic layer includes an abrasive, and a tilt cos η of the ferromagnetic hexagonal ferrite powder with respect to a surface of the magnetic layer acquired by cross section observation performed by using a scanning transmission electron microscope is 0.85 to 1.00.. . ... Fujifilm Corporation

Magnetic tape

Provided is a magnetic tape in which a thickness of a back coating layer is equal to or smaller than 0.20 μm, a c—h derived c concentration calculated from a c—h peak area ratio of c1s spectra obtained by x-ray photoelectron spectroscopic analysis performed on the surface of the back coating layer at a photoelectron take-off angle of 10 degrees, is equal to or greater than 35 atom %, full widths at half maximum of spacing distribution measured by optical interferometry regarding the surface of the back coating layer before and after performing a vacuum heating with respect to the magnetic tape are respectively greater than 0 nm and equal to or smaller than 10.0 nm, and a difference between a spacing measured after performing the vacuum heating and a spacing measured before performing the vacuum heating is greater than 0 nm and equal to or smaller than 8.0 nm.. . ... Fujifilm Corporation

Magnetic tape and magnetic tape device

Provided is a magnetic tape in which the total thickness is equal to or smaller than 5.30 μm, the magnetic layer includes a timing-based servo pattern, a magnetic layer surface ra is equal to or smaller than 1.8 nm, the magnetic layer includes fatty acid ester, a full width at half maximum of spacing distribution measured by optical interferometry regarding the surface of the magnetic layer before performing vacuum heating with respect to the magnetic tape is greater than 0 nm and equal to or smaller than 7.0 nm, a full width at half maximum of spacing distribution measured after performing the vacuum heating is greater than 0 nm and equal to or smaller than 7.0 nm, and a difference between a spacing measured after performing the vacuum heating and a spacing measured before performing the vacuum heating is greater than 0 nm and equal to or smaller than 8.0 nm.. . ... Fujifilm Corporation

Magnetic tape

Provided is a magnetic tape with the total thickness of a non-magnetic and magnetic layers is equal to or smaller than 0.60 μm, a c—h derived c concentration calculated from a c—h peak area ratio of c1s spectra by esca on the surface of the magnetic layer at a photoelectron take-off angle of 10 degrees is equal to or greater than 45 atom %, full widths at half maximum of spacing distribution measured by optical interferometry regarding the surface of the magnetic layer before and after vacuum heating with respect to the magnetic tape are respectively greater than 0 nm and equal to or smaller than 7.0 nm, and a difference between a spacing measured after the vacuum heating and a spacing measured before the vacuum heating is greater than 0 nm and equal to or smaller than 8.0 nm.. . ... Fujifilm Corporation

Magnetic tape

Provided is a magnetic tape in which ferromagnetic powder included in a magnetic layer is ferromagnetic hexagonal ferrite powder having an activation volume equal to or smaller than 1,600 nm3, the magnetic layer includes one or more components selected from the group consisting of fatty acid and fatty acid amide, and an abrasive, a c—h derived c concentration calculated from a c—h peak area ratio of c1s spectra obtained by x-ray photoelectron spectroscopic analysis performed on the surface of the magnetic layer at a photoelectron take-off angle of 10 degrees is equal to or greater than 45 atom %, and a tilt cos θ of the ferromagnetic hexagonal ferrite powder with respect to the surface of the magnetic layer acquired by cross section observation performed by using a scanning transmission electron microscope is 0.85 to 1.00.. . ... Fujifilm Corporation

Magnetic tape

Provided is a magnetic tape in which a center line average surface roughness ra measured regarding a surface of a magnetic layer is equal to or smaller than 1.8 nm, logarithmic decrement acquired by a pendulum viscoelasticity test performed regarding the surface of the magnetic layer is equal to or smaller than 0.050, a back coating layer includes one or more components selected from the group consisting of fatty acid and fatty acid amide, and a c—h derived c concentration calculated from a c—h peak area ratio of c1s spectra obtained by x-ray photoelectron spectroscopic analysis performed regarding a surface of the back coating layer at a photoelectron take-off angle of 10 degrees is equal to or greater than 35 atom %.. . ... Fujifilm Corporation

12/28/17 / #20170372736

Magnetic tape and magnetic tape device

The magnetic tape includes a non-magnetic support; and a magnetic layer including ferromagnetic powder and a binder on the non-magnetic support, in which the total thickness of the magnetic tape is equal to or smaller than 5.30 μm, the magnetic layer includes a timing-based servo pattern, a center line average surface roughness ra measured regarding a surface of the magnetic layer is equal to or smaller than 1.8 nm, the ferromagnetic powder is ferromagnetic hexagonal ferrite powder, the magnetic layer includes an abrasive, and a tilt cos θ of the ferromagnetic hexagonal ferrite powder with respect to a surface of the magnetic layer acquired by cross section observation performed by using a scanning transmission electron microscope is 0.85 to 1.00.. . ... Fujifilm Corporation

12/28/17 / #20170372727

Magnetic tape and magnetic tape device

The magnetic tape includes a non-magnetic support; a non-magnetic layer including non-magnetic powder and a binder on the non-magnetic support; and a magnetic layer including ferromagnetic powder and a binder on the non-magnetic layer, in which the total thickness of the non-magnetic layer and the magnetic layer is equal to or smaller than 0.60 μm, the magnetic layer includes a timing-based servo pattern, and logarithmic decrement acquired by a pendulum viscoelasticity test performed regarding the surface of the magnetic layer is equal to or smaller than 0.050.. . ... Fujifilm Corporation

12/28/17 / #20170372726

Magnetic tape and magnetic tape device

The magnetic tape includes a magnetic layer having ferromagnetic powder and a binder on a non-magnetic support, in which a total thickness of the magnetic tape is equal to or smaller than 5.30 μm, the magnetic layer includes a timing-based servo pattern, a center line average surface roughness ra measured regarding a surface of the magnetic layer is equal to or smaller than 1.8 nm, one or more components selected from the group consisting of fatty acid and fatty acid amide are included in the magnetic layer, and a c—h derived c concentration calculated from a c—h peak area ratio of c1s spectra obtained by x-ray photoelectron spectroscopic analysis performed on the surface of the magnetic layer at a photoelectron take-off angle of 10 degrees is equal to or greater than 45 atom %.. . ... Fujifilm Corporation

12/28/17 / #20170372572

Method for manufacturing housing of radiation detection cassette

Provided is a method for manufacturing a housing of a radiation detection cassette that can appropriately form a recess without a housing material depositing on an end mill or the like, in a case where a recess is formed by working the housing material formed of an alloy containing mg and li. A method for manufacturing a housing of a radiation detection cassette that houses a radiation detector in the housing includes preparing a housing material that is formed of an alloy containing mg and li and contains 0.1 mass % or more of li, forming a recess using a working method other than cutting work on a surface of the housing material, and performing cutting work on the formed recess to shape the recess.. ... Fujifilm Corporation

12/28/17 / #20170372346

Automatic generation of image-based print product offering

A system and method for generating and displaying a print product offering including a plurality of digital images is provided. The method comprises: providing a photo lab computing device comprising a memory, wherein a plurality of digital images are stored in the memory; generating a group of digital images from the plurality of digital images; classifying each of the digital images within the group based on at least one image quality parameter; selecting one or more of the digital images in the group which conform to the at least one image quality parameter; generating an image product template design including the digital images which conform to the at least one image quality parameter; and displaying the image product template design as a print product offering.. ... Fujifilm Corporation

12/28/17 / #20170371453

Transparent conductive film, method of producing transparent conductive film, and touch panel

A transparent conductive film includes a transparent insulating substrate, a first electrode, and a second electrode, in which a first thin metal wire 38 of the first electrode has a first front surface 38a being directed to the viewing side and having a line width w1a, and a first back surface 38b being directed to the side opposite to the viewing side and having a line width w1b, a second thin metal wire 39 of the second electrode has a second front surface 39a being directed to the viewing side and having a line width w2a, and a second back surface 39b being directed to the side opposite to the viewing side and having a line width w2b, the w1a, w1b, w2a, and w2b are 0.5 to 10 μm, w1a is larger than w1b and w2a is larger than w2b.. . ... Fujifilm Corporation

12/28/17 / #20170371452

Touch sensor and touch panel

A touch sensor has one substrate having a plurality of regions that are at least a planar region and a side surface region which is continuous to the planar region and is bent with respect to the planar region, a touch sensor portion provided in the planar region of the substrate, and an antenna provided in a region other than the planar region of the substrate. The substrate is constituted of a flexible transparent substrate. ... Fujifilm Corporation

12/28/17 / #20170371244

Composition for forming upper layer film, pattern forming method, resist pattern, and method for manufacturing electronic device

A composition for forming an upper layer film is applied onto a resist film formed using an actinic ray-sensitive or radiation-sensitive resin composition, and includes a resin x and a compound a having a radical trapping group. A pattern forming method includes applying an actinic ray-sensitive or radiation-sensitive resin composition onto a substrate to form a resist film, applying the composition for forming an upper layer film onto the resist film to form an upper layer film on the resist film, exposing the resist film having the upper layer film formed thereon, and developing the exposed resist film using a developer including an organic solvent to form a pattern.. ... Fujifilm Corporation

12/28/17 / #20170371132

Zoom lens and imaging apparatus

The zoom lens consists of, in order from an object side, a first lens group having a positive power, a second lens group having a negative power, a third lens group having a positive power, a fourth lens group having a negative power, and a fifth lens group having a positive power. An aperture diaphragm is disposed between a surface of the second lens group closest to an image side and a surface of the fourth lens group closest to the object side. ... Fujifilm Corporation

12/28/17 / #20170368863

Flexo printing plate and method for manufacturing flexo printing plate

Provided are a flexo printing plate, which makes it possible to print an image without unevenness by inhibiting bouncing that occurs in a case where the distal end of an image portion of a printing plate contacts a printing target, and a method for producing a flexo printing plate. A region that extends 0.5 mm to 5 mm from a distal end side of the image portion in a printing direction is a lowered region having a height shorter than a height of the image portion other than the region, and the lowered region is gradually lowered toward a non-image portion in a direction orthogonal to the edge on the distal end side of the image portion.. ... Fujifilm Corporation

12/28/17 / #20170368827

Ink jet recording apparatus

There is provided an ink jet recording apparatus that can correct bending of an ink jet head with a compact structure. First supporting frames 122 that support ink jet heads 110c, 110m, 110y, and 110k and second supporting frames 170 that support a part of ink supply sections supplying ink to the ink jet heads 110c, 110m, 110y, and 110k are mounted on a mount 300. ... Fujifilm Corporation

12/28/17 / #20170368736

White polyester film and method for manufacturing same, solar cell back sheet, and solar cell module

Provided are a white polyester film including a polyester and white particles, in which, at an equivalent of a thickness of 250 μm, a machine stretching direction tear strength fmd is 2.5 to 6.0 n, a transverse stretching direction tear strength ftd is 2.0 to 5.0 n, a ratio of the machine stretching direction tear strength fmd to the transverse stretching direction tear strength ftd is 1.05 to 4.00, and a concentration of terminal carboxyl groups is 5 to 25 equivalents/ton, a method for manufacturing the same, a solar cell back sheet and a solar cell module in which the same white polyester film is used.. . ... Fujifilm Corporation

12/28/17 / #20170367675

Mammography apparatus, control device, mammography apparatus control method, and mammography apparatus control program

A mammography apparatus includes: a compression plate that compresses a breast; a moving unit that moves the compression plate in a compression direction in which the breast is compressed and a decompression direction in which the breast is decompressed; a radiation source that emits radiation; and a control unit that controls the moving unit such that the compression plate is moved to a first position in the compression direction, is moved to a second position where the position of the compression plate is changed from the first position by a predetermined variation or more in the decompression direction, and is stopped and performs control such that the radiation is emitted from the radiation source to the breast.. . ... Fujifilm Corporation

12/28/17 / #20170367671

Mammography apparatus, control device, mammography apparatus control method, and mammography apparatus control program

A mammography apparatus includes: a moving unit that moves a compression plate in a compression direction in which the breast is compressed and a decompression direction in which the breast is decompressed; a radiation source; a pressure sensor that is used to measure a compression pressure which is a compression force of the compression plate per unit area; and a control unit that controls the moving unit such that the compression plate is moved to a first position where the compression pressure measured by the pressure sensor is a first compression pressure in the compression direction and is moved to a second position where the compression pressure measured by the pressure sensor is a second compression pressure in the decompression direction and performs control such that radiation is emitted from the radiation source in a state in which the compression plate is located at the second position.. . ... Fujifilm Corporation

12/28/17 / #20170367666

Radiation detection cassette

Provided is a radiation detection cassette that can suppress an artifact resulting from scattered radiation generated within a housing and can further achieve weight reduction and improvement in corrosion resistance. The radiation detection cassette includes a radiation detector that detects radiation, and a housing that houses the radiation detector. ... Fujifilm Corporation

12/28/17 / #20170367587

Photoacoustic measurement apparatus and system

A subject is avascularized while changing the avascularization pressure between the avascularized condition and the non-avascularized condition. A receiving circuit receives a detection signal obtained by detecting a photoacoustic wave generated in the subject by emission of measurement light to the subject. ... Fujifilm Corporation

12/21/17 / #20170366902

Electroacoustic transducer and electroacoustic transduction system

. . . . Provided are an electroacoustic transducer capable of stably reproducing a sound with high acoustic quality and widening a frequency band that is able to be reproduced, and an electroacoustic transduction system. In the electroacoustic transducer including: an electroacoustic transduction film including a polymer composite piezoelectric body in which piezoelectric body particles are dispersed in a viscoelastic matrix formed of a polymer material having viscoelasticity at a normal temperature, and two thin film electrodes laminated on both surfaces of the polymer composite piezoelectric body; and an elastic supporter which is disposed to be closely attached to one principal surface of the electroacoustic transduction film so as to cause the electroacoustic transduction film to be bent, a bent portion of the electroacoustic transduction film has a quadrangular shape, a length of a short side of the bent portion is less than or equal to 10 cm, and a length of a long side thereof is greater than or equal to 30 cm.. ... Fujifilm Corporation

12/21/17 / #20170366789

Projector and method of preventing image deterioration thereof

A projection lens has a lens barrel holding a lens. In a case where an image forming panel is disposed to be shifted with respect to an optical axis of the projection lens, in a second part on a side to which the image forming panel is shifted with respect to the optical axis of the projection lens, there is a great increase in temperature, and in a first part on the opposite side, there is a small increase in temperature. ... Fujifilm Corporation

12/21/17 / #20170366788

Projector and method of preventing image deterioration thereof

In a case where an image forming panel is disposed to be shifted with respect to an optical axis of a projection lens having a lens barrel holding the lens, in the lens barrel, the increase in temperature in a first part on a side to which the image forming panel is shifted is larger than that in a second part on an opposite side. A temperature adjustment section includes a cooling duct, a heating duct, a connecting duct, and blowers 27 and. ... Fujifilm Corporation

12/21/17 / #20170366740

Focusing control device, lens device, imaging apparatus, focusing control method, and focusing control program

The focusing control device capable of preventing deterioration in precision of focusing control from being caused by an error in phase-difference depending on ambient temperature includes: an imaging element that outputs a pair of image signals deviated in one direction on the basis of one subject light image; a phase-difference detection section that detects a phase-difference between the pair of image signals; a temperature detection section; a correction section that corrects the in-focus position of the focus lens based on the detection phase-difference, which is the phase-difference detected by the phase-difference detection section, on the basis of the data in which the temperature, the focus lens position, and the information for in-focus position correction are associated with one another, the temperature which is detected by the temperature detection section, and the focus lens position; and a lens control section that moves the focus lens to the corrected in-focus position.. . ... Fujifilm Corporation

12/21/17 / #20170366731

Imaging apparatus, flicker detection method, and flicker detection program

An imaging apparatus includes: an imaging element; an imaging element driving unit that directs the imaging element to alternately perform imaging operations at a first frame rate and a second frame rate being different from the first frame rate; and a flicker detection unit that detects whether a first flicker of a light source with a first frequency is present and whether a second flicker of a light source with a second frequency is present, based on a captured image signal obtained by an imaging operation at the first frame rate, a captured image signal obtained by an imaging operation at the second frame rate following the imaging operation at the first frame rate and a captured image signal obtained by an another imaging operation at the first frame rate or the second frame rate, wherein the first frame rate and the second frame rate are as defined herein.. . ... Fujifilm Corporation

12/21/17 / #20170366730

Imaging apparatus, flicker detection method, and flicker detection program

An imaging apparatus includes: an imaging element; an imaging element driving unit that directs the imaging element to alternately perform imaging operations at a first frame rate and a second frame rate being different from the first frame rate; and a flicker detection unit that detects whether a first flicker of a light source with a first frequency is present and whether a second flicker of a light source with a second frequency is present, based on a first captured image signal obtained by an imaging operation at the first frame rate and a second captured image signal obtained by an imaging operation at the second frame rate as defined herein, and a sum of a duration of a first frame period based on the first frame rate and a duration of a second frame period based on the second frame rate is a value as defined herein. . ... Fujifilm Corporation

12/21/17 / #20170366709

Image processing apparatus, image processing method, and program

The image processing apparatus (10) includes an image matching unit (14) that performs a process of matching a positional relationship between read image data which is any one of the first read image data (24) and second read image data obtained by color conversion of the first read image data (24) and original document image data (20) of the target printed matter (22); a statistical processing unit (16) that generates statistical information that reflects a distribution of read image signal values of the read image data in each image region of the read image data corresponding to an image region having the same original document image signal values in the original document image data (20); and a mismatching detection unit (18) that detects color mismatching between the original document image data (20) and the target printed matter (22) on the basis of the statistical information.. . ... Fujifilm Corporation

12/21/17 / #20170365486

Pattern processing method, method for manufacturing semiconductor substrate product, and pretreatment liquid for pattern structure

Provided are a pattern processing method for applying a pretreatment liquid for modifying the surface of a pattern structure to a semiconductor substrate provided with the pattern structure, which has at least one of polysilicon, amorphous silicon, ge, or a low dielectric constant material having a k value of 2.4 or less, a method for manufacturing a semiconductor substrate product, and a pretreatment liquid for a pattern structure.. . ... Fujifilm Corporation

12/21/17 / #20170365225

Backlight unit and image display device

The backlight unit includes a light source unit, and a wavelength conversion member disposed on an optical path of light emitted from the light source unit. The light source unit includes a light source allocated to each of the areas, a control of the backlight brightness for each area is performed by controlling a light emission intensity of each light source allocated to each area independently of a light emission intensity of a light source allocated to a different area, and a light source allocated to at least one area includes a light source group including two or more kinds of light sources having different light emission maximum wavelengths, and a light emission intensity of at least one kind of light source included in the light source group is capable of being controlled independently of a light emission intensity of a different light source included in the light source group.. ... Fujifilm Corporation

12/21/17 / #20170365043

Image processing apparatus and method, and non-transitory computer readable medium

There is provided an image processing apparatus, method, and operation program capable of appropriately removing an abnormal pixel even in a case where the abnormal pixel is present in a tailing region. An abnormal pixel removing section removes an abnormal pixel from an image in which tailing and the dot-shaped abnormal pixel are mixed every other line. ... Fujifilm Corporation

12/21/17 / #20170364992

Recommendation device, recommendation system, recommendation method, and program

A recommendation device 10 includes an evaluation reference group information acquisition unit 41 that acquires evaluation reference group information related to a plurality of first products constituting an evaluation reference group, an evaluation rule acquisition unit 43 that acquires an evaluation rule, a first evaluation unit 45 that performs individual evaluation of one-to-one of each of the plurality of first products and a plurality of second products on the basis of the evaluation rule, a second evaluation unit 47 that performs many-to-one overall evaluation on each of the plurality of second products for the evaluation reference group on the basis of the individual evaluation performed by the first evaluation unit, and a recommendation information output unit 49 that outputs recommendation information of the plurality of second products on the basis of the overall evaluation performed by the second evaluation unit.. . ... Fujifilm Corporation

12/21/17 / #20170364991

Merchandise recommendation device, merchandise recommendation method, and program

There are provided a merchandise recommendation device, a merchandise recommendation method, and a program which recommend coordination merchandise based on a sensitivity word according to a trend. A merchandise recommendation device 10 includes a basic merchandise specification unit 31, a recommendation merchandise specification unit 33, and a recommendation merchandise information output unit 34. ... Fujifilm Corporation

12/21/17 / #20170364177

Transfer film, electrode protective film for electrostatic capacitance-type input device, laminate, method for manufacturing laminate, and electrostatic capacitance-type input device

The transfer film includes a temporary support and a photosensitive transparent resin layer formed on the temporary support, in which the photosensitive transparent resin layer includes a binder polymer, a photopolymerizable compound having an ethylenic unsaturated group, a photopolymerization initiator, and a blocked isocyanate, the binder polymer is a carboxyl group-containing acrylic resin having an acid value of 60 mgkoh/g or more, and the transfer film is to protect electrodes in electrostatic capacitance-type input devices.. . ... Fujifilm Corporation

12/21/17 / #20170363959

Coloring photosensitive composition, cured film, pattern forming method, infrared cut filter with light-shielding film, solid-state imaging device, image display device, and infrared sensor

A coloring photosensitive composition includes an oxime ester-based photopolymerization initiator containing a fluorine atom, a polymerizable compound having an ethylenically unsaturated double bond, an alkali-soluble resin, and a colorant, in which in a case where a film having a film thickness after drying of 2.0 μm is formed using the coloring photosensitive composition, the optical density of the film at a wavelength of 365 nm is 1.5 or more.. . ... Fujifilm Corporation

12/21/17 / #20170363955

Nanoimprinting method, and method for producing a droplet arrangement pattern

The disclosed nanoimprinting method suppresses fluctuations in thickness of residual film and defects due to residual gas in a resist film, onto which a pattern of protrusions and recesses is transferred, in a nanoimprinting method that employs the ink jet method to coat a substrate with droplets of resist material. Droplets are coated onto a substrate such that the spaces between the droplets along an a direction which is substantially parallel to the direction of the lines of a linear pattern of protrusions and recesses are longer than the spaces between the droplets in a b direction which is substantially perpendicular to the a direction, in a nanoimprinting method that coats a substrate with the droplets of a resist material using the ink jet method.. ... Fujifilm Corporation

12/21/17 / #20170363940

Projection lens, projector, and method of preventing image deterioration thereof

A projection lens includes: first to fifth lenses; a light shielding ring; an aperture stop; and a lens barrel. The light shielding ring is rotated in a circumferential direction of the lens barrel by a rotation mechanism. ... Fujifilm Corporation

12/21/17 / #20170363899

Transparent conductive film and touch panel

A transparent conductive film having a transmissive region includes a first electrode formed of a first thin metal wire arranged in the transmissive region; and a second electrode formed of a second thin metal wire arranged on a side opposite to a viewing side from the first electrode so as to intersect the first thin metal wire in the transmissive region, in which the first thin metal wire has a first front surface that is directed to the viewing side and has a line width w1a, and a first back surface that is directed to the side opposite to the viewing side and has a line width w1b, the second thin metal wire has a second front surface that is directed to the viewing side and has a line width w2a, and a second back surface that is directed to the side opposite to the viewing side and has a line width w2b, and the line widths w1a, w1b, w2a, and w2b are in a range of 0.5 to 10 μm, and the line widths satisfy a relationship of w1b<w2a≦w1a<w2b.. . ... Fujifilm Corporation

12/21/17 / #20170363857

Endoscopic diagnostic apparatus and lesion part volume measuring method

There are provided a lesion part volume measuring method and an endoscopic diagnostic apparatus capable of easily detecting the volume of a lesion part without using a special treatment instrument. This problem is solved by detecting the position of a distal end portion of a scope hood from an image captured by an endoscope to which the scope hood is attached, finding the volume of the internal space of the scope hood, which is formed by the scope hood and the distal end surface of an insertion part, from the position of the distal end portion of the scope hood and the model of the endoscope and/or the model of the scope hood, and injecting water into the scope hood and detecting the volume of a lesion part from the difference between the water injection amount and the volume of the internal space of the scope hood.. ... Fujifilm Corporation

12/21/17 / #20170363836

Projector

A projection lens has lens holding frames that hold lenses. In a case where an image forming panel is disposed to be shifted with respect to an optical axis of the projection lens, an increase in temperature of a first part on a side to which the image forming panel is shifted with respect to the optical axis l, is greater than that of a second part on the opposite side. ... Fujifilm Corporation

12/21/17 / #20170363791

Polarizing plate

The polarizing plate of the present invention includes a polarizer and an optical element that rotates a polarization plane of polarized light emitted from the polarizer, an orientation direction on a surface of the optical element on a polarizer side is parallel to an absorption axis of the polarizer, an orientation direction on a surface of the optical element opposite to the polarizer is perpendicular to the absorption axis of the polarizer, and Δnd and a birefringence parameter rh of the optical element fall in a range of a predetermined region in an orthogonal coordinate in which Δnd is indicated along a vertical axis and the birefringence parameter rh is indicated along a lateral axis.. . ... Fujifilm Corporation

12/21/17 / #20170363543

Control device of image reading apparatus, operation method thereof, and image detection system

There are provided a control device of an image reading apparatus, an operation method and an operation program thereof, and an image detection system capable of quickly and easily outputting an image having an appropriate density for analysis from an image reading apparatus. An image receiving unit receives a pre-image output in pre-scanning performed before main scanning for outputting a main image for analysis in an image reading apparatus. ... Fujifilm Corporation

12/21/17 / #20170362450

Inks

An ink comprising: (a) from 1 to 25 parts of titanium dioxide pigment; (b) from 0 to 8 parts of a styrene butadiene latex binder; (c) from 0 to 8 parts of a polyurethane latex binder; (d) from 0 to 5 parts of a glycol selected from the group consisting of ethylene glycol, diethylene glycol, propylene glycol, dipropylene glycol or triethylene glycol; (e) from 1 to 10 parts of 2-pyrrolidone; (f) from 1 to 10 parts of glycerol; (g) from 0.01 to 2 parts of an acetylenic surfactant; (h) from 0.001 to 5 parts of biocide; (i) from 0 to 10 parts of a viscosity modifier; and (j) the balance to 100 parts water; provided that (b) plus (c) is greater than 0. Also ink jet printing processes, ink-jet ink containers, printed substrates and ink-jet printers.. ... Fujifilm Corporation

12/21/17 / #20170362429

White polyester film and method for manufacturing same, solar cell back sheet, and solar cell module

Provided are a white polyester film including a polyester and white particles having an average primary particle diameter of 0.20 to 0.40 μm, in which a content of the white particles is 1.0% to 5.0% by mass with respect to the total mass of the film, a ratio of agglomerated particles having particle diameters of 0.40 to 0.80 μm in a direction parallel to a surface direction of the film on the cross-section of the film to the total number of primary particles and agglomerated particles of the white particles dispersed in the film is 10% to 20% by number, and a concentration of terminal carboxyl groups is 6 to 30 equivalents/ton, a method for manufacturing the same, a solar cell back sheet, and a solar cell module.. . ... Fujifilm Corporation

12/21/17 / #20170362400

Optical film, method of manufacturing the optical film, polarizing plate using the optical film, and image display device

There is provided an optical film including: a layer a containing a cyclic olefin-based resin; and a layer b containing a cyclic olefin-based resin, and having a thickness thinner than a thickness of the layer a, wherein a glass transition temperature tg[b] of the layer b is lower than a glass transition temperature tg[a] of the layer a.. . ... Fujifilm Corporation

12/21/17 / #20170361082

Method of producing transdermal absorption sheet

A method of producing a transdermal absorption sheet includes: filling needle-like recessed portions of a mold with a drug solution that is a polymer solution containing a drug; drying the drug solution filling the needle-like recessed portions to form a drug layer containing the drug; supplying a polymer layer forming solution to the mold, the mold provided with a step portion that has a height different from a height of a region in which the needle-like recessed portion is formed in a periphery of the region in which the needle-like recessed portion is formed in a range of equal to or greater than the step portion as seen from above, and then fixing a contact position of the polymer layer forming solution and the mold to the step portion while reducing the polymer layer forming solution; and drying the polymer layer forming solution to form a polymer layer.. . ... Fujifilm Corporation

12/21/17 / #20170361081

Transdermal absorption sheet

Provided is a transdermal absorption sheet capable of improving strength against impact at the time of puncture. A transdermal absorption sheet includes a sheet portion and a plurality of needle-like protruding portions arranged on a first principal surface of the sheet portion, in which the sheet portion has a center portion which is a region in which the plurality of needle-like protruding portions are formed, and an outer edge portion which is a region from the center portion to an end portion, and a maximum thickness of a thickness portion of the outer edge portion is larger than an average thickness of the center portion.. ... Fujifilm Corporation

12/21/17 / #20170361080

Transdermal absorption sheet and method of producing the same

Provided are a transdermal absorption sheet capable of achieving control of the dissolution rate and suppression of diffusion of a drug, and a method of producing the same. A transdermal absorption sheet includes a sheet portion, and a plurality of needle-like protruding portions formed by a plurality of frustum portions arranged on the sheet portion and needle portions arranged on the frustum portions, in which at least one of the needle-like protruding portions has a cavity portion extending from the sheet portion to the frustum portion.. ... Fujifilm Corporation

12/21/17 / #20170360391

Radiation image processing device, method, and program

When performing processing for eliminating scattered radiation included in radiation transmitted through a subject on a radiation image captured by irradiating the subject with radiation, an imaging condition acquisition unit acquires imaging conditions, and a distance information acquisition unit acquires distance information representing the distance between the subject and a radiation detector. A scattered radiation information acquisition unit acquires scattered radiation component information representing a scattered radiation component of radiation included in the radiation image based on at least the imaging conditions, and a correction unit corrects the scattered radiation component information based on the distance information. ... Fujifilm Corporation

12/21/17 / #20170360390

Radiographic imaging system, control device, control method for radiographic imaging systems, and control program for radiographic imaging system

A radiographic imaging system includes a portable information terminal 16 and a console 18 which are plural control devices of which each one performs a control relating to imaging of a radiographic image and of which at least one is selectively used; and a terminal control unit 30 of the portable information terminal 16 and a control unit 50 of the console 18 that respectively function as a setting unit that sets, with respect to at least one of usage control devices which is control device to be selectively used, control content based on one usage control device in a case where the number of usage control devices is one, and sets control content based on a combination of plural usage control devices in a case where the number of usage control devices is plural.. . ... Fujifilm Corporation

12/21/17 / #20170360304

Photoacoustic measurement apparatus and probe

In a photoacoustic measurement apparatus and a probe, artifacts due to photoacoustic waves generated in a surface portion of a subject are reduced without increasing the repetition period of photoacoustic measurement. A measurement light emitting unit emits measurement light toward a subject. ... Fujifilm Corporation

12/21/17 / #20170360287

Light source device and endoscope system

There are provided a light source device, which is more compact and inexpensive than a known light source device, and an endoscope system having a compact and inexpensive light source device. In a light source device, a light source unit includes a first light source that emits blue light, a second light source that emits broadband green light including not only a green component but also a red component, and an optical filter that adjusts the amount of broadband green light for each wavelength. ... Fujifilm Corporation

12/21/17 / #20170360286

Endoscopic diagnosis apparatus, lesion portion size measurement method, program, and recording medium

There are provided an endoscopic diagnosis apparatus, lesion portion size detection method, and a non-transitory computer-readable recording medium that enable easy detection of the size of a lesion portion using an endoscope. This object is achieved by capturing an endoscopic image by emitting light having a regular repetitive pattern onto a subject, detecting, from the endoscopic image, a region in which a repetitive pattern is different from the repetitive pattern of the emitted light, and detecting at least one of a length and area of a lesion portion by using a number of repetitive patterns in the region in which the repetitive pattern is different and a size of a unit of repetition in the repetitive pattern.. ... Fujifilm Corporation

12/21/17 / #20170360285

Image processing device, method, and program

A parameter value regarding an endoscope operation at an arbitrary position on a course is calculated from a three-dimensional image indicating a luminal structure. Specifically, one of a clockwise direction and a counterclockwise direction around an axis is set to positive, the other is set to negative, and a rotation angle of the endoscope due to a rotation operation at a position of a target is calculated so that a sum of a cumulative total of rotation angles of the endoscope due to a rotation operation performed until the distal end portion of the endoscope arrives at the position of the target after the distal end portion of the endoscope is inserted into a luminal structure, and the rotation angle of the endoscope due to the rotation operation at the position of the target falls within a predetermined angle range.. ... Fujifilm Corporation

12/14/17 / #20170358765

Electrode material for organic semiconductor device

An object of the present invention is to provide an electrode material for an organic semiconductor device which maintains excellent conductivity and of which contact properties with an organic semiconductor becomes favorable. The electrode material for an organic semiconductor device of the present invention contains inorganic nanoparticles and an organic π-conjugated ligand, in which the organic π-conjugated ligand is a ligand having at least one electron-withdrawing substituent.. ... Fujifilm Corporation

12/14/17 / #20170358318

Magnetic tape and magnetic tape device

The magnetic tape includes a non-magnetic layer including non-magnetic powder and a binder on a non-magnetic support; and a magnetic layer including ferromagnetic powder and a binder on the non-magnetic layer, in which the magnetic layer includes a timing-based servo pattern, a center line average surface roughness ra measured regarding a surface of the magnetic layer is equal to or smaller than 1.8 nm, one or more components selected from the group consisting of fatty acid and fatty acid amide are at least included in the magnetic layer, and a c—h derived c concentration calculated from a c—h peak area ratio of c1s spectra obtained by x-ray photoelectron spectroscopic analysis performed on the surface of the magnetic layer at a photoelectron take-off angle of 10 degrees is equal to or greater than 45 atom %.. . ... Fujifilm Corporation

12/14/17 / #20170357397

Virtual object display device, method, program, and system

A camera 14 acquires a background image b0, and a virtual object acquisition unit 22 acquires a virtual object s0. A display information acquisition unit 23 acquires display information indicating a position, at which the virtual object s0 is displayed, from the background image b0, and a display control unit 24 displays the virtual object s0 on a display 15 based on the display information. ... Fujifilm Corporation

12/14/17 / #20170355265

Projection type display device and operation assistance method

Provided are a projection type display device and an operation assistance method that enable an operator to enjoy an operation assistance function even in the case of occurrence of abnormality in an optical modulation unit or an image information input unit during operation of a vehicle. A system control unit 47 of a hud, if sensing abnormality in an optical modulation device 44 and a drive unit 45, stops a light source unit 40 and, furthermore, in the case of image information generated by a projected image information generation unit 52 including image information that calls attention of the operator to the front field of view, displays an alert image based on the image information on a liquid crystal display device 61 in a meter cluster.. ... Fujifilm Corporation

12/14/17 / #20170355201

Image-forming device and method for applying varnish

An image-forming device includes a printing portion that forms images on the media being transported using ink, a varnish application portion that applies aqueous varnish to the media on which the images are formed, a treatment portion that performs a treatment on the media so that a stickiness evaluation value which is a stickiness evaluation value indicating a degree of stickiness of the aqueous varnish applied to the media when the media to which the aqueous varnish is applied are output from the varnish application portion and is derived using a damped vibration percentage of a pendulum caused to do pendulum motions from an arbitrary location of the media to which the aqueous varnish is applied as a pivot reaches 0.24 or less, and an accumulation portion that accumulates the media to which the aqueous varnish is applied and on which the treatment is performed.. . ... Fujifilm Corporation

12/14/17 / #20170355173

Pressure-sensitive adhesive sheet for touch panel, laminate for touch panel, and capacitance-type touch panel

An object of the present invention is to provide a pressure-sensitive adhesive sheet for a touch panel which is excellent for the operability of a capacitance-type touch panel, which is able to suppress the occurrence of malfunctions in a capacitance-type touch panel in a wide range of temperature environments from low temperatures to high temperatures, and which is also excellent in pressure-sensitive adhesion. In addition, another object of the present invention is to provide a laminate for a touch panel and a capacitance-type touch panel which include a pressure-sensitive adhesive sheet for a touch panel. ... Fujifilm Corporation

12/14/17 / #20170355022

Magnetic tape and magnetic tape device

The magnetic tape includes a magnetic layer having ferromagnetic powder and a binder on a non-magnetic support, in which the magnetic layer includes a timing-based servo pattern, the ferromagnetic powder is ferromagnetic hexagonal ferrite powder having an activation volume equal to or smaller than 1,600 nm3, and an edge shape of the timing-based servo pattern specified by a magnetic force microscope observation is a shape in which a difference (l99.9−l0.1) between a value l99.9 of a cumulative frequency function of 99.9% of a position deviation width from an ideal shape in a longitudinal direction of the magnetic tape and a value l0.1 of the cumulative frequency function of 0.1% thereof is equal to or smaller than 180 nm.. . ... Fujifilm Corporation

12/14/17 / #20170354320

Endoscopic diagnosis apparatus, image processing method, program, and recording medium

There are provided an endoscopic diagnosis apparatus, image processing method, and recording medium that enable easy measurement of the size of a lesion portion or the like based on an endoscopic image captured through a normal operation without a special operation. A region detecting unit detects, from an endoscopic image, a region of an artificial object or the like that is in contact with a subject. ... Fujifilm Corporation

12/14/17 / #20170354315

Endoscopic diagnosis apparatus, image processing method, program, and recording medium

There are provided an endoscopic diagnosis apparatus, image processing method, and a non-transitory computer-readable recording medium that enable easy measurement of the size of a lesion portion or the like based on an endoscopic image captured through a normal operation without a special operation. A region detecting unit detects, from a position in an endoscopic image, a region having a periodic structure of living tissue. ... Fujifilm Corporation

12/07/17 / #20170353669

Tracking imaging control device, tracking imaging system, camera, terminal device, tracking imaging method, and tracking imaging program

. . . . . . . . A tracking imaging control device includes a target color ratio calculation unit that calculates a ratio at which pixels with a certain range of hue occupy in the histogram as the target color ratio, with reference to the color of the target, and a tracking control unit that controls the pan and/or tilt operation of the camera to cause the camera to track the target, and the tracking control unit controls the pan and/or tilt operation of the camera on the basis of information on the position of the target detected by the first target detection unit when the target color ratio is equal to or lower than a threshold value, and controls the pan and/or tilt operation of the camera on the basis of information on the position of the target detected by the second target detection unit when the target color ratio exceeds the threshold value.. . ... Fujifilm Corporation

12/07/17 / #20170352493

Ruthenium complex dye, dye solution, photoelectric conversion element, and dye-sensitized solar cell

Provided are a ruthenium complex dye having a water content of 0.2% to 4.0% by mass; a dye solution including the ruthenium complex dye; a photoelectric conversion element having semiconductor fine particles having the ruthenium complex dye carried thereon; and a dye-sensitized solar cell including the photoelectric conversion element.. . ... Fujifilm Corporation

12/07/17 / #20170351362

Touch panel

The touch panel includes an image display device, an adhesive layer formed by curing an ultraviolet-curable adhesive, a touch panel sensor, and a protective substrate in this order, the touch panel sensor includes any one polymer film of a cyclic olefin polymer film and a cyclic olefin copolymer film, an ultraviolet absorption layer is provided between the polymer film and the protective substrate, a transmittance of the ultraviolet absorption layer in a wavelength range of 200 to 340 nm is 5% or less, a transmittance of the ultraviolet absorption layer at a wavelength of 400 nm is 86% or more, and a transmittance of the ultraviolet absorption layer in a wavelength range of 400 to 800 nm is in a range of ±3% or less of the transmittance at a wavelength of 400 nm.. . ... Fujifilm Corporation

12/07/17 / #20170351179

Composition for forming upper layer film, pattern forming method using the same, and method for manufacturing electronic device

Provided are a composition for forming an upper layer film for a photoresist, including a polymer having a molecular weight distribution in which a peak area of a high-molecular-weight component having a weight-average molecular weight of 40,000 or more accounts for 0.1% or less with respect to the entire peak area in the molecular weight distribution, measured by the gel permeation chromatography.. . ... Fujifilm Corporation

12/07/17 / #20170351176

Actinic ray-sensitive or radiation-sensitive resin composition, actinic ray-sensitive or radiation-sensitive film, mask blank including actinic ray-sensitive or radiation-sensitive film, pattern forming method, and method for manufacturing electronic device

Provided are an actinic ray-sensitive or radiation-sensitive resin composition including a compound (a) whose dissolution rate in an alkali developer decreases by the action of an acid, a resin (b) having a group that decomposes by the action of an alkali developer to increase the solubility in the alkali developer and having at least one of a fluorine atom or a silicon atom, and a resin (c) having a phenolic hydroxyl group, different from the resin (b), an actinic ray-sensitive or radiation-sensitive film and a mask blank, each formed using the actinic ray-sensitive or radiation-sensitive resin composition, a pattern forming method using the actinic ray-sensitive or radiation-sensitive resin composition, and a method for manufacturing an electronic device.. . ... Fujifilm Corporation

12/07/17 / #20170351147

Laminate and optical film

A laminate is capable of forming an orientation film formed by orienting a rod-like liquid crystal compound or a disk-like liquid crystal compound having a horizontal orientation ability or a vertical orientation ability with respect to a surface of the laminate, on the surface, by using an orientation restraining force of the surface, the laminate including: a cholesteric liquid crystal layer. An optical film sequentially includes: a support; a cholesteric liquid crystal layer; and an orientation film.. ... Fujifilm Corporation

12/07/17 / #20170351051

Imaging lens and imaging apparatus

The imaging lens consists of, in order from the object side, a first lens group having a positive power, a second lens group having a negative power, and a third lens group. The first lens group consists of, in order from the object side, a positive front group, a diaphragm, and a positive rear group. ... Fujifilm Corporation

12/07/17 / #20170351014

Near-infrared absorption composition, cured film, near-infrared absorption filter, solid-state imaging device, and infrared sensor

To provide a near-infrared absorption composition capable of forming a film having excellent visible transparency and near-infrared shieldability, a cured film, a near-infrared absorption filter, a solid-state imaging device, and an infrared sensor. A near-infrared absorption composition includes a compound represented formula (1) and a resin, the compound has a maximum absorption wavelength in a wavelength range of 750 to 830 nm in a film in a case where the film is formed using the near-infrared absorption composition, and a value obtained by dividing an absorbance at a wavelength of 555 nm by an absorbance at the maximum absorption wavelength is 0.10 or less.. ... Fujifilm Corporation

12/07/17 / #20170350006

Method for preparing transparent sheet materials

A method for preparing a transparent sheet material comprising an organic, polymeric substrate and inorganic layers on each side of the substrate, the method comprising the steps of: a) providing an apparatus for generating a glow discharge plasma, said apparatus comprising at least two opposing electrodes, a power supply for the electrodes and a treatment space between the electrodes; b) providing the treatment space with a gas mixture at about atmospheric pressure, the gas mixture comprising a reactive gas and a precursor; and c) moving a transparent substrate through the treatment space comprising the gas mixture at an average speed of at least 1 m/min while applying an electrical potential across the electrodes, thereby generating a glow discharge plasma in the treatment space and depositing an inorganic layer on one or both sides of the substrate; wherein the electrodes apply a discharge energy to the substrate of less than 25 j/cm2.. . ... Fujifilm Corporation

12/07/17 / #20170349774

Ink set and image forming method

Provided is an ink set including an ink composition which contains a colorant and water; and a treatment liquid which contains water-insoluble resin particles in which the content of a carboxy group or a salt of the carboxy group is in a range of 1.0 mmol to 7.0 mmol per 1 g of the water-insoluble resin particles, a compound that causes the colorant in the ink composition to aggregate, and water.. . ... Fujifilm Corporation

12/07/17 / #20170349771

Water dispersion of gel particles, producing method thereof, and image forming method

A water dispersion of gel particles, in which the gel particles having a three-dimensional crosslinked structure including at least one of polymer structure (1) or polymer structure (2), having a hydrophilic group and a polymerizable group, and including photopolymerization initiators are dispersed in water, a method of producing the water dispersion, and an image forming method using the water dispersion are provided. P1 and p2 represent a polymer chain consisting of polyester and the like and having a number-average molecular weight of 500 or greater, z11 represents a (n1+1)-valent group, z12 represents a (m1+1)-valent group, m1, n1 and n2 each represent an integer of 1 or greater, x1 represents a single bond, a —ch2— group, or a —nh— group, z21 represents a (n2+1)-valent group, r1 represents a hydrocarbon group that may include a hetero atom.. ... Fujifilm Corporation

12/07/17 / #20170349691

Composition for magnetic recording medium and magnetic recording medium

An aspect of the present invention relates to a composition, which is a composition for a magnetic recording medium and comprises an isocyanate compound in the form of an adduct of a polyhydroxyl compound having one or more aromatic carbon rings and three or more hydroxyl groups per molecule with a polyisocyanate having two or more isocyanate groups per molecule.. . ... Fujifilm Corporation

12/07/17 / #20170348993

Flexographic printing plate, method for manufacturing flexographic printing plate, and flexographic printing plate precursor

The present invention is to provide a flexographic printing plate having excellent ink uniformity in an image area, particularly, in a solid portion regardless of a printing speed, a method for manufacturing the flexographic printing plate, and a flexographic printing plate precursor used in the manufacturing of the flexographic printing plate. The flexographic printing plate of the present invention is a flexographic printing plate having a relief layer provided with a non-image area, and an image area having an uneven structure formed on the surface, in which a concave portion constituting the uneven structure is formed of at least one of a plurality of grooves having a fixed width extending in one direction or a plurality of hole groups constituted of a plurality of bottomed holes having the same diameter scattered in the one direction, a depth of the concave portion is 2 to 20 μm, each of the plurality of grooves and the plurality of hole groups is arranged in an orthogonal direction orthogonal to the one direction, and the grooves and the bottomed holes respectively have two or more kinds of widths and diameters.. ... Fujifilm Corporation

12/07/17 / #20170348944

Antireflection film and optical member

An antireflection film includes an uneven structure layer that has an uneven structure in which a distance between protrusions is shorter than a wavelength of light of which reflection is to be suppressed and has an alumina hydrate as a main component, and an intermediate layer that is disposed between the uneven structure layer and a substrate. The uneven structure layer has a spatial frequency peak value of the uneven structure of 6.5 μm−1 or greater and a film thickness of 250 nm or more, and the intermediate layer is constituted of a plurality of layers including at least a first layer, a second layer, a third layer, a fourth layer, a fifth layer, a sixth layer, a seventh layer, and an eighth layer in this order from the uneven structure layer side to the substrate side.. ... Fujifilm Corporation

11/30/17 / #20170346018

Composition for forming organic semiconductor film, organic thin film transistor, electronic paper, and display device

. . . . . . . . An object of the present invention is to provide a composition for forming an organic semiconductor film that is excellent in printing properties and makes is possible to prepare an organic thin film transistor excellent in mobility and insulation reliability. Another object of the present invention is to provide an organic thin film transistor, electronic paper, and a display device. ... Fujifilm Corporation

11/30/17 / #20170345200

Image combination apparatus, image combination method, image combination program, and recording medium storing image combination program

An object in a target image to be combined with a combination region of a template image is determined. A plurality of extraction regions which include the determined object and have a shape similar to the shape of the combination region are defined. ... Fujifilm Corporation

11/30/17 / #20170343882

Imaging apparatus, flicker detection method, and flicker detection program

Provided are an imaging apparatus, a flicker detection method, and a flicker detection program that can accurately detect a flicker even in a case in which an image of a bright object is captured. A digital camera directs a mos imaging element 5 to perform a plurality of imaging operations at an arbitrary frame rate and compares captured image signals which are read from the imaging element 5 for frame periods f1 and f2 based on the frame rate to detect whether a flicker has occurred. ... Fujifilm Corporation

11/30/17 / #20170343830

Transparent screen

A transparent screen includes a substrate capable of transmitting light; and a plurality of dots formed on a surface of the substrate, each of the dots having wavelength-selective reflectivity and being formed of a liquid crystal material having a cholesteric structure, in which the cholesteric structure gives a striped pattern of bright parts and dark parts in a cross-sectional view of the dot observed by scanning electron microscope, the dot includes a portion having a height that increases continuously to the maximum height in a direction extending from the edge toward the center of the dot, and in the portion, the angle formed by the normal line to a line that is formed by a first one of the dark parts as counted from the surface of the dot on the opposite side of the substrate and the surface of the dot is in the range of 70° to 90°.. . ... Fujifilm Corporation

11/30/17 / #20170343807

Combiner and head-up display system

According to the invention, provided are a combiner including: a projected image display portion on which a projected image is displayed with projected light; and a base material; in which the projected image display portion at least includes a half-mirror film, the half-mirror film and the base material are provided in this order from an incidence side of the projected light, the half-mirror film includes two or more cholesteric liquid crystal layers, center wavelengths of selective reflection of the two or more cholesteric liquid crystal layers are different from each other, and the cholesteric liquid crystal layer closest to the incidence side of the projected light has the longest center wavelength of selective reflection, and a head-up display system including a projected image display member. The combiner makes it possible to display a projected image having high brightness, in which the generation of a double image is reduced.. ... Fujifilm Corporation

11/30/17 / #20170343806

Windshield glass and head-up display system

According to the invention, provided are a windshield glass including: a projected image display portion on which a projected image is displayed with projected light; and a second glass plate, an intermediate layer, and a first glass plate provided in this order from an incidence side of the projected light, in which the intermediate layer has a wedge-shaped cross section, the projected image display portion at least includes a half-mirror film, and the half-mirror film includes a cholesteric liquid crystal layer, and a head-up display system including the windshield glass. According to the windshield glass of the invention, it is possible to perform a display of a projected image having high brightness, in which generation of a double image is reduced.. ... Fujifilm Corporation

11/30/17 / #20170343779

Imaging optical system, projection-type display apparatus, and imaging apparatus

An imaging optical system consists of a first optical system and a negative second optical system in order from a magnified side. The second optical system forms an intermediate image, and the first optical system forms the intermediate image on a magnified-side conjugate plane. ... Fujifilm Corporation

11/30/17 / #20170343778

Imaging optical system, projection-type display apparatus, and imaging apparatus

In the imaging optical system that consists of a first optical system and a second optical system in order from a magnified side, and has an intermediate image formed between the first optical system and the second optical system, a focus group moving during focusing is included between a most magnified side of the first optical system and a position at which a principal ray of light having a maximum angle of view and an optical axis of the first optical system intersect each other, and a predetermined conditional expression relating to the focus group is satisfied.. . ... Fujifilm Corporation

11/30/17 / #20170343775

Imaging optical system, imaging apparatus, and projection-type display apparatus

An imaging optical system that conjugates a reduced-side conjugate point, a magnified-side conjugate point, and a position of an internal intermediate image with each other includes, continuously in order from a most magnified side, a negative lens group and a positive lens. The negative lens group consists of three or more negative lenses. ... Fujifilm Corporation

11/30/17 / #20170343705

Antireflection film and method of producing the same, and optical member

An antireflection film includes an uneven structure layer that has an uneven structure and has an alumina hydrate as a main component, and an intermediate layer that is disposed between the uneven structure layer and a substrate. The uneven structure layer has a spatial frequency peak value of the uneven structure of 8.5 or greater and has a film thickness of 200-250 nm, and the intermediate layer comprises a plurality of layers including at least a first layer, a second layer, a third layer, and a fourth layer.. ... Fujifilm Corporation

11/30/17 / #20170342181

Curable composition, cured product, optical component, lens, and compound

Disclosed herein are a curable composition which is capable of producing a cured product having a low abbe's number and increased durability, and a curable composition with suppressed viscosity increase. Provided is a compound represented by general formula (a). ... Fujifilm Corporation

11/30/17 / #20170342171

Water dispersion of gel particles, producing method thereof, and image forming method

Provided are a water dispersion of gel particles in which the gel particles which have a three-dimensional crosslinked structure including a thioether bond and an ethylenic double bond, have a hydrophilic group, and include a photopolymerization initiator are dispersed in water, a producing method of the water dispersion, and an image forming method using the water dispersion.. . ... Fujifilm Corporation

11/30/17 / #20170342091

Near-infrared absorption composition, cured film, near-infrared cut filter, solid-state imaging device, infrared sensor, and compound

To provide a near-infrared absorption composition which contains a squarylium compound having excellent solvent solubility, a cured film which uses the near-infrared absorption composition, a near-infrared cut filter, a solid-state imaging device, an infrared sensor, and a compound. A near-infrared absorption composition includes a compound represented by the following formula (1) and a resin. ... Fujifilm Corporation

11/30/17 / #20170341419

Method of producing printed products

A printed product is produced by applying at least one colored and water-containing ink to image regions on a printing material in a drop-on-demand process, applying a substantially colorless and water-containing liquid a) to non-image regions and/or b) to image regions that have little ink in a drop-on-demand process and drying the printing material. In this case, the printing material has a coating with at least one acid. ... Fujifilm Corporation

11/30/17 / #20170341186

Soundproof structure and soundproof structure manufacturing method

A soundproof structure has one or more soundproof cells. Each of the one or more soundproof cells includes a frame having a through-hole, a film fixed to the frame, and an opening portion configured to include one or more holes drilled in the film. ... Fujifilm Corporation

11/30/17 / #20170340241

Endoscopic examination support device, endoscopic examination support method, and endoscopic examination support program

A bronchial image generation unit generates a bronchial image and a position information acquisition unit acquires position information of an endoscope in a bronchus. A passage position information acquisition unit acquires passage position information representing a passage position of the endoscope and a passage propriety information acquisition unit acquires passage propriety information representing portions through which the endoscope can be passed and a portion through which the endoscope cannot be passed. ... Fujifilm Corporation

11/23/17 / #20170336555

Optical member, optical element, liquid crystal display device, and near-to-eye optical member

. . . . . . Provided is an optical member having a high brightness, a low haze, and a small color change, an optical element, a liquid crystal display device, and a near-to-eye optical member. The optical member includes a plurality of cholesteric liquid crystal dots that are provided on a substrate, in which a shape of each of the dots is a hemispherical or elliptical hemispherical shape in which the substrate side is planar, a conical or elliptical conical shape in which the substrate side is set as the bottom, or a shape in which a plurality of shapes selected from the shapes are laminated, the cholesteric liquid crystal dot has a reflection center wavelength with respect to visible light, the cholesteric structure of the dot has a stripe pattern including bright portions and dark portions in a cross-sectional view of the dot when observed with a scanning electron microscope, the dot includes a portion having a height which continuously increases to a maximum height in a direction moving from an end portion of the dot to the center of the dot, and in the portion, an angle between a normal line perpendicular to a line, which is formed using a first dark portion from a surface of the dot opposite to the substrate, and the surface of the dot is in a range of 70° to 90°.. ... Fujifilm Corporation

11/23/17 / #20170335372

Specimen disrupting method and specimen disrupting apparatus

A specimen disrupting apparatus includes: a drive unit that rotates the lower portion of a container having a solution that includes a specimen, a great number of small diameter beads, and a large diameter bead stored therein; and a control unit that controls the drive unit. The control unit controls the drive unit such that the lower portion of the container rotates at two or more different rotational speeds which are changed continuously.. ... Fujifilm Corporation

11/23/17 / #20170335252

Stripping compositions for removing photoresists from semiconductor substrates

This disclosure relates to compositions containing 1) at least one water soluble polar aprotic organic solvent; 2) at least one quaternary ammonium hydroxide; 3) at least one compound comprising at least three hydroxyl groups; 4) at least one carboxylic acid; 5) at least one group ii metal cation; 6) at least one copper corrosion inhibitor selected from the group consisting of 6-substituted-2,4-diamino-1,3,5-triazines; and 7) water. The compositions can effectively strip positive or negative-tone resists or resist residues, and be non-corrosive to bumps and underlying metallization materials (such as snag, cunisn, cucocu, cosn, ni, cu, al, w, sn, co, and the like) on a semiconductor substrate.. ... Fujifilm Corporation

11/23/17 / #20170334291

Projection display system and method of controlling projection display device

A projection display system and a control method of controlling a projection display device capable of preventing degradation of visibility or occurrence of a sense of discomfort at a boundary between respective projection areas due to dimming are provided. In a system including a plurality of projection display devices 100a to 100c that project image light onto a plurality of areas in one projection surface, each of the plurality of projection display devices includes a brightness detection unit 47b, and a first control unit 52 that controls a projection condition for the image light that is projected on the basis of detected brightness information, and a second control unit 53 performs control to cause a projection condition for the image light of the second projection display device 100b to match a projection condition determined by the first control unit 52 of the first projection display device 100a.. ... Fujifilm Corporation

11/23/17 / #20170334209

Nozzle surface wiping device, liquid discharge apparatus, and head cleaning method

A nozzle surface wiping device capable of using a plurality of types of wiping members in a state where discharge deterioration is suppressed regarding the respective wiping members is provided. In the nozzle surface wiping device that wipes a nozzle surface of a liquid discharge head with a wiping member to which a cleaning liquid is applied, information on cleaning liquid application conditions for applying respective saturated liquid amounts of the cleaning liquid to a plurality of types of wiping members, respectively, according to the types of the respective wiping members is held in advance. ... Fujifilm Corporation

11/23/17 / #20170334166

Barrier laminate, gas barrier film, and device employing the same

The present invention provides a barrier laminate, comprising an organic layer and an inorganic barrier layer adjacent to the organic layer, characterized in that the organic layer comprises a polymer obtained by polymerizing a polymerizable compound having two or more polymerizable groups per molecule, and has a refractive index of 1.60 or higher, and in that the refractive index of the inorganic barrier layer is 1.60 or higher. The gas barrier film exhibits high barrier properties and transparence.. ... Fujifilm Corporation

11/23/17 / #20170333846

Composite anion exchange membrane, method for producing the same, ion exchange membrane module, and ion exchange device

The composite anion exchange membrane includes: a surface layer on a single surface or both surfaces of an anion exchange membrane substrate, in which the above-described surface layer contains a copolymer of a monomer a which is a water-soluble polyfunctional monomer and a monomer b which is a cationic monomer, an anion exchange capacity of the above-described surface layer is 0.05 meq/cm3 to 0.50 meq/cm3, and an anion exchange capacity of the above-described anion exchange membrane substrate is 1.0 meq/cm3 to 5.0 meq/cm3.. . ... Fujifilm Corporation

11/23/17 / #20170333835

Gas separation membrane, gas separation module, gas separation apparatus, gas separation method, and method for producing asymmetric gas separation membrane

A gas separation membrane has a gas separation layer containing a crosslinked cellulose resin. The crosslinked cellulose resin has a particular linking structure in a crosslinked structure. ... Fujifilm Corporation

11/23/17 / #20170333342

Method of producing transdermal absorption sheet

A method of producing a transdermal absorption sheet includes: filling needle-like recessed portions on a mold having the needle-like recessed portions with a polymer solution; drying the filled polymer solution to form a polymer layer; and peeling off the polymer layer, wherein, in drying the polymer solution, low rate drying conditions are set in a concentration range in which an average solid content concentration of the polymer solution is 70 wt % to 80 wt %. When a constant drying rate of water is used as an index, in the concentration range in which the average solid content concentration of the polymer solution is 70 wt % to 80 wt %, and the constant drying rate is lower than a maximum value of a constant drying rate under a drying condition where the average solid content concentration of the polymer solution is less than 70 wt % and more than 80 wt %.. ... Fujifilm Corporation

11/16/17 / #20170331030

Electroacoustic transduction film and manufacturing method of electroacoustic transduction film

. . Provided are an electroacoustic transduction film in which conversion between a vibration and a voltage is able to be appropriately performed without the occurrence of dielectric breakdown of the air between upper and lower thin film electrodes even when a high voltage is applied therebetween, a user is able to be prevented from coming into contact with a piezoelectric layer, and high productivity is achieved, and a manufacturing method of an electroacoustic transduction film. A piezoelectric layer which stretches and contracts in response to a state of an electric field, an upper thin film electrode formed on one principal surface of the piezoelectric layer, a lower thin film electrode formed on the other principal surface of the piezoelectric layer, an upper protective layer formed on the upper thin film electrode, and a lower protective layer formed on the lower thin film electrode are included, and a groove which penetrates the thin film electrode and the protective layer is formed in at least a portion of an outer peripheral portion in a surface direction of at least one of the upper thin film electrode and the upper protective layer, or the lower thin film electrode and the lower protective layer.. ... Fujifilm Corporation

11/16/17 / #20170330828

Multilayer wiring substrate

Provided is a multilayer wiring substrate capable of achieving excellent conduction reliability. The multilayer wiring substrate is formed by laminating an anisotropic conductive member including an insulating base which is made of an inorganic material, a plurality of conductive paths which are made of a conductive member, penetrate the insulating base in a thickness direction thereof and are provided in a mutually insulated state, and a pressure sensitive adhesive layer which is provided on a surface of the insulating base, in which each conductive path has a protrusion protruding from the surface of the insulating base, and a wiring substrate having a substrate and one or more electrodes to be formed on the substrate, and conductive paths which come into contact with the electrode among the plurality of conductive paths are deformed so that adjacent conductive paths come into contact with each other.. ... Fujifilm Corporation

11/16/17 / #20170330346

Camera device, imaging system, control method, and program

A camera device according to an aspect of the invention includes an imaging unit, an imaging direction adjustment unit, a direction control unit that controls the imaging direction adjustment unit, a camera-side tracking processing unit that analyzes captured image data to acquire first target information indicating the position of a tracking target and outputs the first target information, a camera-side communication unit that receives second target information from a terminal device, and a camera-side target information correction unit that corrects the first target information on the basis of the second target information.. . ... Fujifilm Corporation

11/16/17 / #20170330335

Tracking system, terminal device, camera device, tracking imaging method, and program

In a preferred aspect of the present invention, at least one of a camera-side controller or a terminal-side controller performs a tracking image generation process (p1) of generating tracking image data from captured image data. Further, at least one of the camera-side controller or the terminal-side controller performs a tracking calculation process (p2) of acquiring target information on the basis of the tracking image data. ... Fujifilm Corporation

11/16/17 / #20170329225

Photosensitive resin composition, planographic printing plate precursor, method for producing planographic printing plate, and polymer compound

Provided is a photosensitive resin composition, including: a polymer compound which has a polycyclic structure and a sulfonamide group in a main chain thereof; and an infrared absorbent, wherein the polycyclic structure has at least one structure selected from the group consisting of a fused cyclic hydrocarbon structure and a fused polycyclic aromatic structure.. . ... Fujifilm Corporation

11/16/17 / #20170329170

Terminal connection structure of conductive film for touch panel and touch panel

External connection terminals in a conductive film and circuit-side terminals in a flexible circuit are respectively arranged in a first direction and are disposed through an anisotropic conductive membrane so as to at least partially overlap each other, the conductive film has detection electrodes and lead wires respectively connecting the detection electrodes to the external connection terminals, at least two external connection terminals have connection portions with the lead wires disposed at different locations, and, in each external connection terminal, an overlapping region between the circuit-side terminal and the anisotropic conductive membrane has ends in a second direction orthogonal to the first direction, and a width w1 of a first end in the first direction being located on a connection portion side between the external connection terminal and the lead wire is smaller than a width w2 in the first direction of the external connection terminal overlapping the first end.. . ... Fujifilm Corporation

11/16/17 / #20170329100

Prism unit

In a color separation prism that includes a first and second prism blocks bonded to each other, the first and second prism blocks are bonded to the first and second adhesive portions of the first and second base plates, respectively. The first and second base plates are fixed to the first and second base plate-fixing portions of a base with the first and second base-fixing portion interposed therebetween, respectively. ... Fujifilm Corporation

11/16/17 / #20170329063

Optical film, polarizing plate, and image display device

An object of the present invention is to provide an optical film having excellent alignment, and a polarizing plate and an image display device using the same. The optical film of the present invention is an optical film having at least an optically anisotropic layer, and the optically anisotropic layer contains a smectic liquid crystal compound not including a fluorine atom and a compound partially having a cyclohexane ring in which the hydrogen atom is substituted with a linear alkyl group.. ... Fujifilm Corporation

11/16/17 / #20170328976

Operation device, tracking system, operation method, and program

An operation device according to an aspect of the invention includes: a receiving unit that receives images; a tracking target receiving unit that receives a specified tracking target which is tracked by the camera; a movement amount calculation unit that calculates the amount of movement of the tracking target in the images; a movement amount determination unit that determines whether the amount of movement calculated by the movement amount calculation unit is equal to or greater than a first movement amount threshold value; and a size instruction transmission unit that transmits an instruction to change the size of the image transmitted by the camera from a first size to a second size smaller than the first size to the camera in a case in which the movement amount determination unit determines that the amount of movement is equal to or greater than the first movement amount threshold value.. . ... Fujifilm Corporation

11/16/17 / #20170328541

Wavelength conversion member, backlight unit, image display device, and method of manufacturing wavelength conversion member

A wavelength conversion member, is provided with a wavelength conversion layer that includes quantum dots and is interposed between two barrier layers. The wavelength conversion member includes a light scattering layer that is provided between the barrier layers and the wavelength conversion layer, in which one of the barrier layers closest to the light scattering layer is formed of an inorganic component, the light scattering layer includes a binder, which is formed of either a compound having a hydrogen bonding functional group and a polymerizable group in a molecule or an organic metal coupling agent, and scattering particles having a diameter r of 0.2 to 5 μm, a thickness d of the light scattering layer is 0.2 to 4 μm, a thickness d of the wavelength conversion layer is 10 to 100 μm, and a ratio of d to d is 0.2% to 10%.. ... Fujifilm Corporation

11/16/17 / #20170327963

Production method of mold, manufacturing method of pattern sheet, production method of electroform, production method of mold using electroform, and original

Provided are a production method of a mold, a manufacturing method of a pattern sheet, a production method of an electroform, a production method of a mold using an electroform, and an original. The production method includes: preparing an original having an inclined portion which is formed in an enclosed shape on an outer peripheral portion of a protruding pattern formed at a center portion on a base and gradually increases in thickness from inside toward outside, and a thermoplastic resin sheet; and forming a recessed pattern on the thermoplastic resin sheet by pressing the original which is heated against the thermoplastic resin sheet at a position where a flat surface of the original and a surface of the thermoplastic resin sheet are separated from each other, cooling the original in the state where the original is pressed, and separating the original from the thermoplastic resin sheet.. ... Fujifilm Corporation

11/16/17 / #20170325783

Systems and methods of determining dimensions of structures in medical images

Systems and methods for producing ultrasound images are disclosed herein. In one embodiment, ultrasound image data are acquired in discrete time increments at one or more positions relative to a subject. ... Fujifilm Corporation

11/09/17 / #20170324067

Laminate and image display device

. . . . An object of the invention is to provide a novel laminate and a novel image display device which have both of a gas barrier function and a circular polarization conversion function and have a reduced thickness as compared to those in the related art. A laminate of the invention has a substrate, an organic layer a, an inorganic layer b, and an organic layer b in this order, and at least one of the organic layer a or the organic layer b contains a liquid crystal compound.. ... Fujifilm Corporation

11/09/17 / #20170322490

Pattern forming method, method for producing electronic device, and actinic ray-sensitive or radiation-sensitive resin composition for organic solvent development

A method for producing an electronic device includes the pattern forming method, and an actinic ray-sensitive or radiation-sensitive resin composition for organic solvent development. Specifically, provided is a pattern forming method, including a film forming step of forming a film by an actinic ray-sensitive or radiation-sensitive resin composition, an exposure step of irradiating the film, and a development step of developing the film using a developer containing an organic solvent, in which the composition contains a resin containing a repeating unit having an si atom and a repeating unit having an acid-decomposable group and a compound capable of generating an acid upon irradiation with actinic rays or radiation, the content of si atoms in the resin is 1.0 to 30 mass %, and the content of the resin in the total solid content of the composition is 20 mass % or more.. ... Fujifilm Corporation

11/09/17 / #20170322436

Polymerizable composition, wavelength conversion member, backlight unit, and liquid crystal display device

A polymerizable composition provides a high brightness and suppressed decrease in brightness in an outer peripheral region when used in a wavelength conversion member, a wavelength conversion member, a backlight unit, and a liquid crystal display device. The polymerizable composition includes quantum dots having surfaces coordinated with a ligand, a polymerizable compound, and a dispersant, in which the ligand is a molecule that includes a saturated hydrocarbon chain having 6 or more carbon atoms and a coordinating group, a log p value of the polymerizable compound is 3.0 or lower, the dispersant has a nonpolar and a polar portion in a molecule, and the nonpolar portion is at least one selected from the group consisting of a saturated hydrocarbon chain having 6 or more carbon atoms, an aromatic ring, and a saturated aliphatic ring. ... Fujifilm Corporation

11/09/17 / #20170322405

Phase contrast microscope

The phase contrast microscope includes: an illumination optical system 10 that emits illumination light for phase difference measurement to an observation target placed in a container; an adjustment optical system 20 that is provided between the illumination optical system 10 and the observation target s, has at least one optical element 21, and adjusts refraction of the illumination light due to a liquid surface shape of a liquid c in the container 60; an imaging unit 40 that images the observation target to which the illumination light has been emitted; and an adjustment optical system control unit 51 that adjusts optical characteristics of the adjustment optical system 20 based on uniformity of a density of an image captured by the imaging unit 40 and a density contrast.. . ... Fujifilm Corporation

11/09/17 / #20170322358

Polarizing plate, front panel of display device, display apparatus, substrate of touch panel, resistive film-type touch panel, and capacitance-type touch panel

Provided is a polarizing plate including a base material, an interlayer, an adhesive layer, and a polarizer layer in this order, in which the base material contains at least a resin film and has a thickness of equal to or greater than 120 μm, the interlayer is a cured layer obtained by curing a thermosetting composition containing a thermally cross-linkable compound in a proportion of equal to or higher than 0.10% by mass with respect to a total amount of solid content of the composition, and a modulus of elasticity ea of the base material, a modulus of elasticity eb of the interlayer, and a modulus of elasticity ec of the adhesive layer satisfy expression 1: ea>eb>ec. Also provided are a front panel of a display device, a display apparatus, a substrate of a touch panel, a resistive film-type touch panel, and a capacitance-type touch panel.. ... Fujifilm Corporation

11/09/17 / #20170322345

Hardcoat film, polarizing plate, liquid crystal display, and method for manufacturing hardcoat film

A hardcoat film including a support and a hardcoat layer, in which the support contains a resin as a main component, a film thickness of the hardcoat layer exceeds 20 μm, the hardcoat layer contains a structure derived from a compound which has one alicyclic epoxy group and one ethylenically unsaturated double bond group and has a molecular weight equal to or less than 300, and a structure derived from a compound which has 3 or more ethylenically unsaturated double bond groups, a radical polymerization initiator and a cationic polymerization initiator.. . ... Fujifilm Corporation

11/09/17 / #20170321116

Wavelength conversion member, backlight unit including wavelength conversion member, liquid crystal display device, and method of manufacturing wavelength conversion member

Provided is a wavelength conversion member including: a wavelength conversion layer including at least one kind of quantum dots that are excited by excitation light to emit fluorescence and are dispersed in an organic matrix; and a barrier layer that is provided adjacent to at least one main surface of the wavelength conversion layer and includes silicon nitride and/or silicon oxynitride as a major component, in which the organic matrix is obtained by curing a curable composition including at least an alicyclic epoxy compound and includes a chemical structure a which is bonded to silicon nitride and/or silicon oxynitride as a major component of the barrier layer.. . ... Fujifilm Corporation

11/09/17 / #20170321115

Wavelength conversion member, backlight unit including wavelength conversion member, liquid crystal display device, and method of manufacturing wavelength conversion member

Provided is a wavelength conversion member including: a wavelength conversion layer including at least one kind of quantum dots that are excited by excitation light to emit fluorescence and are dispersed in an organic matrix; an intermediate layer that is provided adjacent to at least one main surface of the wavelength conversion layer; and a barrier layer that is provided adjacent to a main surface of the intermediate layer opposite to the wavelength conversion layer and includes silicon nitride and/or silicon oxynitride as a major component, in which the organic matrix is obtained by curing a curable composition including at least an alicyclic epoxy compound, and the intermediate layer includes a chemical structure a which is bonded to silicon nitride and/or silicon oxynitride as a major component of the barrier layer and a chemical structure b which is bonded to the organic matrix.. . ... Fujifilm Corporation

11/09/17 / #20170321114

Phosphor dispersion composition, phosphor molded body obtained using the same, wavelength conversion film, wavelength conversion member, backlight unit, and liquid crystal display device

Provided is a wavelength conversion film-forming composition which forms a wavelength conversion film by being applied to a substrate to form a coating film and curing the coating film, the wavelength conversion film-forming composition including at least quantum dots, a volatile component, and a binder that is soluble in the volatile component and/or a binder precursor that is soluble in or compatible with the volatile component, in which the wavelength conversion film-forming composition is gellable in the presence of the volatile component.. . ... Fujifilm Corporation

11/09/17 / #20170321074

Printing ink

The present invention provides an inkjet ink comprising: 6-35% by weight of nvc; 5-60% by weight of pea; 15-35% by weight of a c8.12 alkane diol di(meth)acrylate; a radical photoinitiator; and a colorant, wherein the percentages by weight are based on the total weight of the ink. The present invention further provides an inkjet ink set wherein at least one of the inks in the set, preferably all of the inks in the set, is an inkjet ink as defined above. ... Fujifilm Corporation

11/09/17 / #20170320353

Autograph support device

The autograph support device includes a supporting member that supports an image carrier having a planar image display surface such that the image display surface that displays a mirror-image image of an image displayed on a planar writing surface is located one side of the normal direction of the writing surface of a writing medium having the writing surface, and a half mirror that is arranged between the writing surface and the image display surface to reflect at least a portion of light from the one side of the nomal direction of the writing surface above and allow a portion of the light to be transmitted therethrough, and the image display surface and the writing surface are arranged at an equal optical distance with a planar mirror surface of the half mirror interposed therebetween.. . ... Fujifilm Corporation

11/09/17 / #20170320351

Lithographic printing plate precursor, method of producing same, and printing method using same

Provided are a lithographic printing plate precursor for furnishing a lithographic printing plate in which adhesion to interleaving paper is prevented, contamination inside a device is prevented, and edge stain does not occur; a method of producing the same; and a printing method using the same. The lithographic printing plate precursor includes: a support; and an image recording layer on the support, in which a region of a surface of the lithographic printing plate precursor at a side of the image recording layer, which is from an end portion of the lithographic printing plate precursor to a portion inside the end portion by 5 mm, contains at least one polymer selected from polyamide, polyurethane, polyurea, polyester and polycarbonate, and has a content of the polymer per unit area which is greater than a content of the polymer per unit area in a region other than the above-described region by an amount of 10 mg/m2 or greater.. ... Fujifilm Corporation

11/09/17 / #20170320307

Functional composite film and quantum dot film

A functional composite film includes one or more combinations of an inorganic layer and an organic layer as underlying base of the inorganic layer on a support, and having the outermost surface with an organic layer thereon, where the organic layer on the outermost surface is formed using an ultraviolet-curable urethane polymer having a weight-average molecular weight of 5,000 to 30,000 and a double bond equivalent of 300 g/mol or more, which has a urethane polymer as the main chain and a side chain having a (meth)acryloyl group at a terminal; a curable urethane polyester; and at least one phosphoric acid compound containing two or less (meth)acryloyl groups and/or a silane coupling agent containing one (meth)acryloyl group, and a quantum dot film using the same. High adhesiveness is obtained between the organic layer and the inorganic layer, and when a quantum dot layer or the like is laminated thereon.. ... Fujifilm Corporation

11/09/17 / #20170320306

Functional composite film and wavelength conversion film

Provided are a functional composite film having one or more combinations of an inorganic layer and an underlying organic layer on one surface thereof, and having a light diffusion layer on the opposite surface, in which the light diffusion layer is formed by dispersing a light diffusing agent in a binder formed using a graft copolymer having a molecular weight of 10,000 to 3,000,000 and an acryl equivalent of 500 g/mol or more, which has an acrylic polymer as the main chain and at least one of a urethane polymer with an acryloyl group at a terminal or a urethane oligomer with an acryloyl group at a terminal in the side chain; and a wavelength conversion film using the same. Using these, a functional composite film and a wavelength conversion film, having good light diffusion performance and light transmittance are provided.. ... Fujifilm Corporation

11/09/17 / #20170320302

Far infrared reflective film, dispersion for forming far infrared reflective film, manufacturing method of far infrared reflective film, far infrared reflective glass, and window

Provided are a far infrared reflective film including a support, and a fibrous silver particles-containing layer provided on the support, in which the fibrous silver particles-containing layer includes fibrous silver particles, and a sol-gel hardened material obtained by hydrolysis and polycondensation of a metal coupling agent including a functional group capable of interacting with the fibrous silver particles, and an alkoxide compound, which has excellent heat insulating properties, film hardness, and surface properties; a dispersion for forming a far infrared reflective film; a manufacturing method of a far infrared reflective film; a far infrared reflective glass; and a window.. . ... Fujifilm Corporation

11/09/17 / #20170319182

Ultrasound diagnostic apparatus, sound velocity setting method, and recording medium

An ultrasound diagnostic apparatus performs transmission and reception of ultrasonic waves for forming focal points used to set sound velocities at predetermined timing such that sound velocities having been set for all of respective segment regions established by diving a subject are all reset every predetermined number of frames. Owing to this configuration, it becomes possible for the ultrasound diagnostic apparatus to suitably reset sound velocities of ultrasonic waves in the subject and also reduce the amount of calculation for resetting sound velocities.. ... Fujifilm Corporation

11/09/17 / #20170319173

Acoustic wave image generating apparatus and control method thereof

There are provided an ultrasound image generating apparatus, which generates a high-quality ultrasound image even in a deep portion of a subject, and a control method thereof. In an ultrasound image (img), for a portion (ar1) equal to or less than a depth threshold value (d1), a real scanning line (l1) obtained from an acoustic wave echo signal is used. ... Fujifilm Corporation

11/09/17 / #20170319078

Photoacoustic measurement device and laser light source

A flash lamp 32 excites a laser rod 31. A q switch 35 which changes the loss of the optical resonator according to the voltage applied is inserted on the optical path of a pair of mirrors 33 and 34 forming the optical resonator. ... Fujifilm Corporation

10/26/17 / #20170310898

Image display apparatus, image-taking apparatus and image display method

. . The image display apparatus according to an aspect of the present invention comprises: an image input device which inputs an image signal; a particular target detection device which detects a particular target included in the image signal based on a particular target evaluation value indicating the feature of the particular target; a frame display information generation device which generates frame display information indicating a frame surrounding the detected particular target and which causes the frame to change continuously or by stages according to the particular target evaluation value; and a display device which displays the frame based on the generated frame display information. That is, by causing the frame to change continuously or by stages according to the evaluation value of a particular target, it is possible to avoid sudden change in the frame display.. ... Fujifilm Corporation

10/26/17 / #20170309492

Removal liquid and method for removing oxide of group iii-v element, treatment liquid for treating compound of group iii-v element, oxidation prevention liquid for preventing oxidation of group iii-v element, treatment liquid for treating semiconductor substrate, and method for producing semiconductor substrate product

Provided are a removal liquid for removing an oxide of a group iii-v element, an oxidation prevention liquid for preventing the oxidation of an oxide of a group iii-v element or a treatment liquid for treating an oxide of a group iii-v element, each liquid including an acid and a mercapto compound; and a method using each of the same liquids. Further provided are a treatment liquid for treating a semiconductor substrate, including an acid and a mercapto compound, and a method for producing a semiconductor substrate product using the same.. ... Fujifilm Corporation

10/26/17 / #20170308254

Image display control device, image display control method, image display control program, and recording medium having the program stored thereon

A facial image that a user desires to look for from among a plurality of detected facial image displayed in a first facial image display area is clicked, and the clicked facial image is displayed in a third facial image display area. A facial image that is similar to the facial image displayed in the third facial image display area and is suitable for printing is looked for among from the plurality of detected facial image displayed in the first facial image display area, and displayed in a second facial image display area. ... Fujifilm Corporation

10/26/17 / #20170307769

Portable radiographic image capturing apparatus

A portable radiographic image capturing apparatus includes a radiation conversion panel configured to output image information on the basis of applied radiation, a casing housing the radiation conversion panel therein, and a plurality of support members on which the radiation conversion panel is supported in the casing. The support members have slot structures housing wires therein.. ... Fujifilm Corporation

10/26/17 / #20170307603

Immunochromatographic kit

The immunochromatographic kit includes an inspection strip which includes an insoluble carrier spreading the specimen liquid, a label-holding pad including a label substance modified with a first substance bondable to a test substance, a liquid-sending pad sending a first amplification liquid to the insoluble carrier, and an absorption pad disposed in contact with the other end of the insoluble carrier and sequentially has an inspection region including a second substance being bonded to the test substance, a confirmation region including a substance bondable to the first substance, and an amplification index region including a substance being reacted with the first amplification liquid between the label-holding pad and the absorption pad of the insoluble carrier, a first pot being disposed below the liquid-sending pad and enclosing the first amplification liquid, and a second pot being disposed above the absorption pad and enclosing a second amplification liquid in a housing case.. . ... Fujifilm Corporation

10/26/17 / #20170306279

Cell culture device and cell culture method

A culture container has a first inflow port and a first outflow port. The first flow path connects the first outflow port to the first inflow port. ... Fujifilm Corporation

10/26/17 / #20170305145

Pattern formation device, liquid ejection device, and electrical fault detection method

A pattern formation device, a liquid ejection device, and an electrical fault detection method capable of detecting electrical fault of a liquid ejection head on the basis of an analysis result of an electrical fault detection pattern are provided. An electrical fault detection pattern having an arrangement of dot arrays satisfying an arrangement condition with an arrangement of a plurality of ejection elements in a liquid ejection head is formed by ejecting liquid from a liquid ejection head in which m rows of ejection element groups in which a plurality of ejection elements are arranged in a first direction are arranged in a second direction intersecting the first direction, and m is an integer equal to or greater than 2.. ... Fujifilm Corporation

10/26/17 / #20170304503

Tubular structure, device for manufacturing tubular structure, and method for manufacturing tubular structure

An object of the present invention is to provide a cell-containing bioabsorbable tubular structure having molecular permeability, a device for manufacturing the tubular structure, and a method for manufacturing the tubular structure. According to the present invention, there is provided a tubular structure constituted with a cell structure which contains biocompatible polymer blocks and cells, in which the plurality of polymer blocks is disposed in voids between the plurality of cells.. ... Fujifilm Corporation

10/26/17 / #20170304458

Method for preparing microcarriers, microcarriers, and application thereof

Objects of the present invention are to provide a preparation method which makes it possible to obtain porous microcarriers having unique properties and a unique particle size distribution and to provide porous gelatin microcarriers having excellent cell growth properties. According to the present invention, there are provided a method for preparing porous recombinant gelatin microcarriers that includes an emulsification step in which an emulsifier having a specific hlb value is used in a specific amount, and provided porous gelatin microcarriers having specific voids.. ... Fujifilm Corporation

10/26/17 / #20170304196

Orally disintegrating tablet and method for producing same

An orally disintegrating tablet including: fine granules, each fine granule having, at its center, an active pharmaceutical ingredient-containing core that includes butylscopolamine bromide and water-insoluble particles, and having an intermediate layer that includes water-insoluble particles and coats the active pharmaceutical ingredient-containing core, and a bitterness-masking layer that includes talc and at least one water-insoluble polymer, in sequence from the active pharmaceutical ingredient-containing core side; and an excipient component positioned on the outside of the fine granules, and a method for producing the same.. . ... Fujifilm Corporation

10/12/17 / #20170294005

Restoration filter generation device and method, image processing device and method, imaging device, and non-transitory computer-readable medium

A restoration filter generation device which generates a restoration filter for performing a restoration process on luminance system image data, the restoration process being based on a point-image distribution in an optical system, the luminance system image data being image data relevant to luminance and being generated based on image data for each color of multiple colors, the restoration filter generation device including an mtf acquisition device which acquires a modulation transfer function mtf for the optical system; and a restoration filter generation device which generates the restoration filter based on the modulation transfer function mtf, the restoration filter suppressing an mtf value of image data for each color of the multiple colors to 1.0 or less at least in a region of a particular spatial frequency or less, the image data for each color of the multiple colors corresponding to the luminance system image data after the restoration process.. . ... Fujifilm Corporation

10/12/17 / #20170294004

Restoration filter generation device and method, image processing device and method, imaging device, and non-transitory computer-readable medium

A restoration filter generation device which generates a restoration filter for performing a restoration process on luminance system image data, the restoration process being based on a point-image distribution in an optical system, the luminance system image data being image data relevant to luminance and being generated based on image data for each color of multiple colors, the restoration filter generation device including an mtf acquisition device which acquires a modulation transfer function mtf for the optical system; and a restoration filter generation device which generates the restoration filter based on the modulation transfer function mtf, the restoration filter suppressing an mtf value of image data for each color of the multiple colors to 1.0 or less at least in a region of a particular spatial frequency or less, the image data for each color of the multiple colors corresponding to the luminance system image data after the restoration process.. . ... Fujifilm Corporation

10/12/17 / #20170294003

Restoration filter generation device and method, image processing device and method, imaging device, and non-transitory computer-readable medium

A restoration filter generation device which generates a restoration filter for performing a restoration process on luminance system image data, the restoration process being based on a point-image distribution in an optical system, the luminance system image data being image data relevant to luminance and being generated based on image data for each color of multiple colors, the restoration filter generation device including an mtf acquisition device which acquires a modulation transfer function mtf for the optical system; and a restoration filter generation device which generates the restoration filter based on the modulation transfer function mtf, the restoration filter suppressing an mtf value of image data for each color of the multiple colors to 1.0 or less at least in a region of a particular spatial frequency or less, the image data for each color of the multiple colors corresponding to the luminance system image data after the restoration process.. . ... Fujifilm Corporation

10/12/17 / #20170293210

Projection device, projector, and image adjustment method

A projection unit has a zoom adjustment unit, an image-plane correction unit, a first drive unit, and a solenoid-actuator. The zoom adjustment unit enlarges or reduces a projected-image by moving a first lens group in a k direction. ... Fujifilm Corporation

10/12/17 / #20170293106

Focusing control device, focusing control method, focusing control program, lens device, and imaging device

A focusing control device includes a filter processing unit 11a which performs first filter processing selected from among a plurality of kinds of filter processing on each of a first signal group output from a plurality of phase difference detection pixels 52a and a second signal group output from a plurality of phase difference detection pixels 52b, a correlation calculation unit 11b which performs correlation calculation of the first signal group after the first filter processing and the second signal group after the first filter processing, and a lens position control unit 11c which controls a position of a focus lens based on the result of the correlation calculation. The filter processing unit 11a selects the first filter processing from among the plurality of kinds of filter processing based on subject condition information.. ... Fujifilm Corporation

10/12/17 / #20170291440

Ink jet recording device and density unevenness correction method therefor

In an ink jet recording device in which a paper supporting part is constituted by a first support and a second support having a comb teeth structure, a region where paper is supported by only the first support is defined as a first region, a region where the paper is supported by only the second support is defined as a second region, and a region where the paper is supported by the first support and the second support is defined as a third region. Charts including a plurality of grayscales for the respective regions are drawn. ... Fujifilm Corporation

10/12/17 / #20170290570

Puncture range determination apparatus and method

Provided are a puncture range determination apparatus and a puncture range determination method in which the hardness of tissue is considered as well as blood vessels. A blood vessel (32) is detected through performing doppler processing. ... Fujifilm Corporation

10/05/17 / #20170289461

Imaging device, imaging method, and program

. . . . . . An imaging device includes an imaging optical system that includes a first optical system and a second optical system having a common optical axis and having different focal lengths, an imaging element that includes a first sensor group selectively receiving light passing the first optical system and a second sensor group selectively receiving light passing the second optical system, and an image compositing unit that generates a first generated image by performing registration on a plurality of first captured images captured in different states of an optical axis l of the first optical system and by compositing the registrated plurality of first captured images and that generates a second generated image by performing registration on a plurality of second captured images captured in different states of the optical axis l of the second optical system and by compositing the registrated plurality of second captured images.. . ... Fujifilm Corporation

10/05/17 / #20170289441

Focusing control device, imaging device, focusing control method, and focusing control program

Disclosed are a focusing control device, an imaging device, a focusing control method, and a focusing control program capable of enabling focusing on an eye region and obtaining an intended focusing result. The focusing control device includes a focusing position determination unit 34 which determines a focusing position based on a captured image signal obtained by imaging a subject with an imaging element 5 while moving a focus lens, and an af region determination unit 33 which determines an af region based on a face region detected from a captured image signal obtained through imaging with the imaging element 5 at an arbitrary time and an eye region detected from a captured image signal obtained through imaging at a time before the arbitrary time. ... Fujifilm Corporation

10/05/17 / #20170288152

Composition for forming organic semiconductor film, organic semiconductor film, manufacturing method thereof, organic semiconductor element, and manufacturing method thereof

A composition for forming an organic semiconductor film includes an organic semiconductor represented by formula a-1, a polymer, a solvent having a boiling point of 150° c. Or higher and an sp value of 18 to 23, and a silicone compound having a structure represented by formula d-1.. ... Fujifilm Corporation

10/05/17 / #20170288151

Composition for forming organic semiconductor film and organic semiconductor element

A composition for forming an organic semiconductor film includes an organic semiconductor represented by the following formula a-1, and a solvent having a boiling point of from 150° c. To 300° c. ... Fujifilm Corporation

10/05/17 / #20170288144

All solid state secondary battery, solid electrolyte composition used therefor, electrode sheet for battery, and method for manufacturing electrode sheet for battery and all solid state secondary battery

Provided are an all solid state secondary battery having a positive electrode active material layer, an inorganic solid electrolyte layer, and a negative electrode active material layer in this order, in which at least one layer of the positive electrode active material layer, the inorganic solid electrolyte layer, or the negative electrode active material layer includes a polymer and an inorganic solid electrolyte, in which the polymer is a crosslinking polymer having both of hetero atoms and carbon-carbon unsaturated bonds not contributing to aromaticity in a main chain, and the inorganic solid electrolyte contains a metal belonging to group i or ii of the periodic table and has an ion conductivity of the metal being contained, a solid electrolyte composition being used therefor, an electrode sheet for a battery, and a method for manufacturing an electrode sheet for a battery and an all solid state secondary battery.. . ... Fujifilm Corporation

10/05/17 / #20170287603

Production method for metal oxide particles, metal oxide powder, and magnetic recording medium

A production method for metal oxide particles includes: obtaining precursor particles of a metal oxide by performing a synthesis reaction of the precursor particles in the presence of an organic compound; and converting the obtained precursor particles into metal oxide particles by heating an aqueous solution containing the precursor particles to 300° c. Or higher and pressurizing the aqueous solution at a pressure of 20 mpa or higher.. ... Fujifilm Corporation

10/05/17 / #20170287526

Magnetic tape cartridge

A magnetic tape cartridge includes a substantially rectangular box shaped case that houses, inside a housing area, a single reel wound with a magnetic tape and equipped with a reel plate that is attracted and held by magnetic force when loaded into a drive device, and a metal-containing block that is disposed inside the case and outside the housing area of the reel, and has a proportion of metal by mass to a total mass of metal provided inside the case including the reel equipped with the magnetic tape and the reel plate of 18% or greater.. . ... Fujifilm Corporation

10/05/17 / #20170287517

Hexagonal ferrite powder and magnetic recording medium

Hexagonal ferrite powder has an average particle size falling within a range of 10 nm to 50 nm, a switching field distribution sfd23° c. Measured at a temperature of 23° c. ... Fujifilm Corporation

10/05/17 / #20170287515

Hexagonal ferrite powder, magnetic recording medium, and method of hexagonal ferrite powder

The hexagonal ferrite powder has an activation volume of greater than or equal to 800 nm3 but less than 1,200 nm3, a rare earth atom content falling within a range of 0.5 to 8.0 atom % per 100 atom % of iron atoms, and a localized presence of rare earth atoms in the surface layer portion, as well as is in the form of ellipsoidal powder.. . ... Fujifilm Corporation

10/05/17 / #20170287130

Data sorting apparatus, data sorting method, and data sorting program

Plural pieces of data where n (n>2) elements are arranged in a predetermined-direction in a specific-order are sorted into any one of n labels using a graph-cut-process. Each of the plural pieces of data has scores indicating element-likenesses for the plural respective elements. ... Fujifilm Corporation

10/05/17 / #20170286807

Image processing apparatus, image processing method, and recording medium

In the image processing apparatus, the theme determiner determines a theme of the image group based on the image analysis information, and the preference analyzer analyzes a preference of the user based on the theme of the image group. The composite image generator uses a certain number of images corresponding to the preference of the user selected, respectively, from among the plurality of images to generate composite images of a plurality of patterns. ... Fujifilm Corporation

10/05/17 / #20170285482

Organic processing liquid and pattern forming method

Disclosed herein are an organic processing liquid for resist film patterning which is capable of suppressing the occurrence of defects in resist patterns, and a pattern forming method. Provided is an organic processing liquid for resist film patterning, which is used to carry out at least one of developing or cleaning of a resist film obtained from an actinic ray-sensitive or radiation-sensitive composition, the liquid including an organic solvent, in which the content of an oxidant in the organic processing liquid is 10 mmol/l or less.. ... Fujifilm Corporation

10/05/17 / #20170285365

Imaging apparatus and image blur correction method

An imaging apparatus includes: a detection unit that detects accelerations in directions of three orthogonal axes; a generation unit that, in a case in which a difference between the magnitude of a resultant vector of the accelerations in the directions of the three orthogonal axes and the magnitude of the acceleration of gravity is equal to or less than a predetermined threshold value, generates a reference vector using the resultant vector; and a correction unit that corrects an image blur caused by translational shakes in directions of two orthogonal axes perpendicular to at least an optical axis of an imaging optical system, using the reference vector, on the basis of the accelerations in the directions of the three orthogonal axes.. . ... Fujifilm Corporation

10/05/17 / #20170285322

Objective optical system for endoscope and endoscope

An objective optical system for an endoscope consists of a front group, an aperture stop, and a positive rear group in order from an object side. The front group consists of a negative first lens having a smaller absolute value of a curvature radius of a lens surface on an image side than that on an object side, and one or more parallel planar members of which an incidence surface and an emission surface are perpendicular to an optical axis, in order from the object side. ... Fujifilm Corporation

10/05/17 / #20170283701

Polymer, composition, optical film, and liquid crystal display device

A polymer is obtained by polymerizing a monomer having two or more radical polymerizable double bonds and one or more hydroxyl groups. A composition including the polymer, an optical film including a cholesteric liquid crystal layer containing the polymer on a support, and a liquid crystal display device including at least a backlight unit including the optical film and a liquid crystal cell are provided.. ... Fujifilm Corporation

10/05/17 / #20170283587

Curable composition, infrared cut filter with light-shielding film, and solid-state imaging device

The present invention provides a curable composition which is suitably used for the production of a light-shielding film which has excellent light-shielding properties, exhibits low reflectivity, has excellent pattern linearity, and is not susceptible to chipping; an infrared cut filter with a light-shielding film; and a solid-state imaging device. The curable composition according to the present invention includes a curable compound which has at least one selected from the group consisting of a fluorine atom, a silicon atom, a linear alkyl group having 8 or more carbon atoms, and a branched alkyl group having 3 or more carbon atoms, and a curable functional group; a silane coupling agent; and a black pigment.. ... Fujifilm Corporation

10/05/17 / #20170282535

Image forming apparatus and image correcting method

A image forming apparatus includes: a device that detects abnormality of an image caused by abnormality of a nozzle in an inkjet head and a correcting device that performs correction by making a part of a plurality of nozzles non-ejectable based on a detection result of the abnormality and by compensating for it by another nozzle. The correcting device includes a plural non-ejection correcting device that performs correction by making two or more nozzles non-ejectable with respect to one abnormal nozzle and a single non-ejection correcting device that performs correction by making one abnormal nozzle non-ejectable with respect to the one abnormal nozzle. ... Fujifilm Corporation

10/05/17 / #20170282417

Manufacturing method of sheet having needle-like protruding portions

The manufacturing method of the sheet having the needle-like protruding portions includes: preparing a mold including needle-like recessed portions, and a solution supply device including a slit-like opening formed at a nozzle distal end portion; supplying a solution from the solution supply device to the mold in a state that the nozzle distal end portion is pressed to a front surface of the mold, and filling the solution in the needle-like recessed portions; and moving the solution supply device relatively to the mold in a state that the nozzle distal end portion is brought into contact with the front surface of the mold, and, as a hardness distribution in a thickness direction of the mold, an average value of a young's modulus at a part within 40 μm from the front surface of the mold is 1.9 mpa or higher and 100 mpa or lower.. . ... Fujifilm Corporation

10/05/17 / #20170282215

Dual frequency ultrasound transducer including an ultrahigh frequency transducer stack and a low frequency ultrasound transducer stack

A dual frequency ultrasound transducer includes a high frequency ultrasound array and a low frequency transducer positioned behind or proximal to the high frequency ultrasound array. In one embodiment, a dampening material is positioned between a rear surface of the high frequency array and the a front surface of the low frequency array. ... Fujifilm Corporation

10/05/17 / #20170282144

Method for producing liposome and apparatus for producing liposome

Disclosed herein are a method for producing a liposome which is capable of reducing the facility costs and also capable of rapid desolvation, and an apparatus for producing a liposome which is for use in the above-mentioned method. Provided is a method for producing a liposome, including a stirring step of stirring a mixed liquid containing an oil phase in which at least one lipid is dissolved in an organic solvent and a water phase, and an evaporating step of evaporating an organic solvent from the mixed liquid, in which the condensed organic solvent is removed by passing a gas having a temperature not higher than the dew point of the solvent in the evaporating step.. ... Fujifilm Corporation

10/05/17 / #20170281543

Method for producing liposome and apparatus for producing liposome

Disclosed herein are a method for producing a miniaturized liposome on a large production scale, and an apparatus for producing a liposome which is to be used in the above-mentioned method. Provided is a method for producing a liposome, including a step of stirring a mixture containing an oil phase in which at least one lipid is dissolved in an organic solvent and a water phase in a first tank of an apparatus having the first tank and a circulation path, in which the ratio of the capacity of the circulation path to the total capacity of the tank and the circulation path is 0.4 or less and/or the time required for the mixture to return to the first tank after being discharged therefrom is within 2.0 minutes.. ... Fujifilm Corporation

10/05/17 / #20170281132

Acoustic wave image generating apparatus and control method thereof

There are provided an acoustic wave image generating apparatus and a control method thereof for making an insertion needle clear. A first ultrasound image is generated using ultrasound echo signals obtained from a first plurality of ultrasound transducers. ... Fujifilm Corporation

10/05/17 / #20170281131

Hardness deriving device, medical imaging system, hardness deriving method and hardness deriving program storage medium

A hardness deriving device includes: an acquisition section configured to acquire plural ultrasound images obtained by ultrasound imaging a breast in a state in which the breast is pressed by a pressing member at a plurality of different pressures; and a deriving section configured to find an amount of change at corresponding points between the plural ultrasound images acquired by the acquisition section, and to derive information indicating a hardness of tissue of the breast based on the amount of change at the corresponding points.. . ... Fujifilm Corporation

10/05/17 / #20170281124

Acoustic matching member, acoustic matching member group, and medical imaging apparatus

An acoustic matching member configured to be disposed between a breast placed on an imaging table and a compression plate disposed opposite to the imaging table is proposed. The acoustic matching member includes a protruding portion that protrudes toward the imaging table and that is provided in an end portion on a deepest side when viewed from a chest wall side of a subject in a case of compressing a breast of the subject in contact with the compression plate.. ... Fujifilm Corporation

10/05/17 / #20170281083

Sensor device and sensor system

There are provided a sensor device and a sensor system that consume less power, can be miniaturized, and are excellent in productivity. The sensor device has: a unit 1 having at least one type of power supply portion 13 selected from a power generation portion and a wireless power supply portion, a sensor portion 11 that detects target information and outputs a signal, a logic portion 12 that performs determination based on the signal, and a wireless communication portion 14 that transmits a result of the determination to the outside; and a sealing material that covers at least a part of the outer periphery of the unit 1. ... Fujifilm Corporation

10/05/17 / #20170280637

Film for agricultural greenhouse and agricultural greenhouse

Objects of the present invention are to provide a film for an agricultural greenhouse that can maintain a co2 concentration necessary for the photosynthesis of plants even when ventilation is not performed and to provide an agricultural greenhouse using the film. The film for an agricultural greenhouse of the present invention is a cellulose film which contains a cellulose acylate resin and has an equilibrium moisture content of 4% to 8% at a temperature of 25° c., a relative humidity of 80% and a thickness of 60 to 200 μm.. ... Fujifilm Corporation

09/28/17 / #20170280094

Projection display device and light source control method thereof

. . A projection display device and a light source control method thereof capable of improving visibility of specific information without increasing a manufacturing cost and a power consumption amount are provided. An hud includes a plurality of light sources that emit light beams with different colors, a projection unit that projects light according to image information among the light beams emitted from the plurality of light sources onto a combiner, and a light source control unit that sequentially emits lights from the plurality of respective light sources according to a predetermined light emission amount pattern. ... Fujifilm Corporation

09/28/17 / #20170280045

Imaging apparatus and method of recognizing target object

The imaging apparatus includes: an imaging optical system that is formed of a wide-angle optical system and a telephoto optical system having a common optical axis; a directional sensor; a panning/tilting mechanism that rotates an imaging section, which includes the imaging optical system and the directional sensor, in horizontal and vertical directions; and an image acquisition section that respectively acquires a wide-angle image, and a telephoto image, and a first target object is detected from a wide-angle image, the panning/tilting mechanism is controlled on the basis of information about a position of the detected first target object within the wide-angle image, and image recognition is performed on a telephoto image, when the first target object is positioned at the center of the wide-angle image, thereby recognizing the first target object or a second target object.. . ... Fujifilm Corporation

09/28/17 / #20170278540

Magnetic tape and magentic tape device

The magnetic tape has a timing base servo pattern on the magnetic layer, wherein the centerline average surface roughness ra on the surface of the magnetic layer is less than or equal to 1.8 nm, the magnetic layer contains a fatty acid ester, the full width at half maximum of spacing distribution measured by optical interferometry on the surface of the magnetic layer before and after vacuum heating the magnetic tape is greater than 0 nm but less than or equal to 7.0 nm, the difference of spacing measured by optical interferometry on the surface of the magnetic layer after and before vacuum heating the magnetic tape is greater than 0 nm but less than or equal to 8.0 nm.. . ... Fujifilm Corporation

09/28/17 / #20170278533

Magnetic tape and magnetic tape device

The magnetic tape has a magnetic layer containing ferromagnetic powder and binder on a nonmagnetic support, wherein a timing based servo pattern is present on the magnetic layer, the centerline average surface roughness ra that is measured on the surface of the magnetic layer is less than or equal to 1.8 nm, and the coefficient of friction that is measured on the base portion of the surface of the magnetic layer is less than or equal to 0.35.. . ... Fujifilm Corporation

09/28/17 / #20170277962

Physiological sensor controller, physiological sensor system and non-transitory computer readable medium

A physiological sensor controller controls a physiological sensor (or ecg sensor), positioned on a patient body, for measuring physiological information (or ecg waveform) of the patient body to output a measurement signal. An acquisition device acquires a verification image containing portions of identification information of the physiological sensor and a face of the patient body. ... Fujifilm Corporation

09/28/17 / #20170277022

Rear converter lens and imaging apparatus

Provided are a rear converter lens and an imaging apparatus capable of achieving favorable optical performance and an appropriate back focal length with high magnification. The rear converter lens rcl consists of, in order from the object side, four lens-groups of positive, negative, negative, and positive lens-groups. ... Fujifilm Corporation

09/28/17 / #20170277002

Wavelength conversion member, backlight unit, and liquid crystal display device

The invention provides a wavelength conversion member including a wavelength conversion layer which includes a second cured product and a first cured product dispersed as spheres in the second cured product, the first cured product being obtained by curing a first polymerizable composition including a quantum dot and a first polymerizable compound, and the second cured product being obtained by curing a second polymerizable composition including a second polymerizable compound. The invention further provides a backlight unit and a liquid crystal display device including the wavelength conversion member.. ... Fujifilm Corporation

09/28/17 / #20170276987

Optical member and image display device including optical member

An optical member includes: a substrate; and a dot that is in contact with a surface of the substrate, in which the dot is formed of a liquid crystal material having a cholesteric structure, the substrate includes a liquid crystal layer that is formed on the surface in contact with the dot, and the liquid crystal layer is a layer in which orientation of a liquid crystal compound is immobilized. The optical member includes a dot in a shape having a large maximum height with respect to a diameter, the dot being formed of a liquid crystal material having a cholesteric structure in which orientation disorder is reduced. ... Fujifilm Corporation

09/28/17 / #20170276915

Zoom lens and imaging apparatus

The zoom lens includes, in order from an object side, a positive first lens group g1, a negative second lens group g2, a positive third lens group g3, a diaphragm, and a fourth lens group g4. During zooming, only the second lens group g2 and the third lens group g3 move. ... Fujifilm Corporation

09/28/17 / #20170274690

Method and apparatus for detecting streak, and printing apparatus

At least a part of an inspection image is divided into a finite number of local regions by allowing overlap in a first direction. A streak intensity signal quantitatively showing intensity of a streak for a position in a second direction intersecting with the first direction is created for each of the local regions. ... Fujifilm Corporation

09/28/17 / #20170273652

Image processing device, radiographic imaging system, image processing method, and non-transitory computer readable medium

The present disclosure provides an image processing device including: a radiographic image acquisition section that acquires a radiographic image, the radiographic image generated by stitching together radiographic images of an imaging subject imaged by plural radiation detectors, each of which includes a detection face for detecting radiation; a purpose acquisition section that acquires information indicating an interpreting purpose; and an adding section that adds a predetermined assist line to the radiographic image, on the basis of at least one of a reference object corresponding to the interpreting purpose in the radiographic image acquired by the radiographic image acquisition section or the information indicating the interpreting purpose.. . ... Fujifilm Corporation

09/28/17 / #20170273649

Image-processing device, radiation image capture system, image-processing method, and computer-readable storage medium

An overall controller of a console acquires a radiation image of an imaging subject captured by a radiation image capture device for radiographic imaging. The overall controller also acquires body thickness information indicating a body thickness of the imaging subject in a direction in which radiation passes through. ... Fujifilm Corporation

09/21/17 / #20170272646

Photographing apparatus, method and medium using image recognition

Processing for judging whether a face is included in a frame is performed, in a predetermined interval, on each of frames included in a moving image of a subject, displayed on a monitor, until the judgment becomes positive. If it is judged that a face is included in a frame, the facial position is detected in the frame, and stored. ... Fujifilm Corporation

09/21/17 / #20170270678

Device and method for image registration, and non-transitory recording medium

A second registration unit performs registration between an intraoperative live view obtained by an image obtaining unit and an associated image obtained by an associated image obtaining unit. At this time, the second registration unit extracts a plurality of feature points corresponding to one another from a registered intraoperative image registered with the associated image and a newly obtained intraoperative image, sets priority levels on the feature points corresponding to one another based on the associated image, obtains positional information indicating a relative positional difference between the registered intraoperative image and the newly obtained intraoperative image based on the feature points with the priority levels set thereon, and performs registration between the associated image and the newly obtained intraoperative image based on the positional information.. ... Fujifilm Corporation

09/21/17 / #20170270353

Image processing apparatus, image processing method, program, and recording medium

There are provided an image processing apparatus, an image processing method, a program, and a recording medium capable of calculating the actual intimacy between persons even in a case where there is a deviation in the actual intimacy between persons by calculating the intimacy between persons in consideration of only the contents of images. In the image processing apparatus, the image processing method, the program, and the recording medium of the invention, a person specifying unit determines persons appearing in each image, and specifies one or more first persons among the determined persons. ... Fujifilm Corporation

09/21/17 / #20170269365

Projection display device and temperature control method thereof

A hud includes a light source unit 57, a light modulation element 54 that modulates light that is emitted from the light source unit 57, a projection portion that projects the modulated light onto a projection surface, wind guide paths 61 and 62 that guide wind w sent from an air conditioning device 9 of a car 100 to the light source unit 57, the wind guide path 61 that guides the wind w to the light modulation element 54, a shutter 63 for performing blocking and opening of the wind guide paths 61 and 62, and a system control unit 64 that selectively performs control for blocking the wind guide paths 61 and 62 and control for opening the wind guide paths 61 and 62 by controlling the shutter 63.. . ... Fujifilm Corporation

09/21/17 / #20170269364

Projection-type display device, safe-driving support method, and safe-driving support program

Provided are a projection-type display device, a safe-driving support method, and a non-transitory computer readable recording medium storing a safe-driving support program capable of securing safety while providing sufficient information to a driver even in a situation where a field of vision in a traveling direction of a motor vehicle is poor. An hud includes a light modulation unit that modulates light emitted from a light source unit; a projection unit that projects the light modulated by the light modulation unit onto a combiner; a first image information generation unit that generates first image information and outputs the first image information to the light modulation unit; a second image information generation unit that generates second image information and outputs the second image information to a display device; and a control unit that controls operations of the first image information generation unit and the second image information generation unit.. ... Fujifilm Corporation

09/21/17 / #20170269363

Projection-type display device, electronic device, driver viewing image sharing method, and driver viewing image sharing program

Provided are a projection-type display device, an electronic device, a driver viewing image sharing method, and a non-transitory computer readable recording medium storing a driver viewing image sharing program. An hud comprises a captured image data acquisition unit that acquires captured image data from an imaging unit that captures ahead of a windshield, a projection image data generation unit that analyzes the acquired captured image data and generates projection image data, a projection unit that modulates light emitted from a light source unit according to the projection image data and projects the modulated light onto a combiner, a driver viewing image data generation unit that generates driver viewing image data in which the projection image data is overlapped on the captured image data, and a communication unit that transmits the driver viewing image data to an electronic device that includes a display unit and exists in the motor vehicle.. ... Fujifilm Corporation

09/21/17 / #20170269327

Imaging lens and imaging apparatus

An imaging lens includes, in order from the object side to the image side: a first lens having a negative refractive power and a concave surface toward the image side; a positive second lens having a negative refractive power; a third lens having a positive refractive power and a convex surface toward the image side; a fourth lens having a convex surface toward the image side; a fifth lens having a positive refractive power and a convex surface toward the image side; and a sixth lens having a negative refractive power and a concave surface toward the object side. Predetermined conditional formulae related to first lens, the second lens, and the third lens are satisfied.. ... Fujifilm Corporation

09/21/17 / #20170269326

Imaging apparatus and focusing control method

Provided is an imaging apparatus capable of performing af with a high precision regardless of an object while realizing increase in af speed. When there is an af instruction, photographing is performed while a focus lens is moved. ... Fujifilm Corporation

09/21/17 / #20170269273

Optical member and image display device including optical member

Provided is an optical member including: a substrate; and a dot that is in contact with a surface of the substrate, in which the dot is formed of a liquid crystal material having a cholesteric structure, and the dot exhibits wavelength selective reflecting properties having two or more reflection peaks. By using the optical member according to the present invention, an image display device in which erroneous detection of data input is reduced can be provided.. ... Fujifilm Corporation

09/21/17 / #20170269272

Optical member and image display device including optical member

Provided is an optical member including: a substrate; and a dot that is in contact with a surface of the substrate, in which the dot is formed of a liquid crystal material having a cholesteric structure, four or more dots form one recognition effective region as an aggregate, and a shortest inter-end distance between one arbitrary dot and at least two other dots in the recognition effective region is 10 μm or less. In the optical member, even when a dot pattern is observed in an oblique direction, retroreflection properties are exhibited and the intensity of reflected light is high. ... Fujifilm Corporation

09/21/17 / #20170269270

Coloring composition, method for producing coloring composition, color filter, pattern forming method, method for manufacturing color filter, solid-state imaging device, and image display device

A coloring composition includes color index pigment red 264, a graft resin having an acid group, a photopolymerizable compound, and a photopolymerization initiator.. . ... Fujifilm Corporation

09/21/17 / #20170267005

Printing apparatus and control method thereof

A control method for a printing apparatus includes: an image defect detecting step of detecting an ejection curve amount of a nozzle in an inkjet head and an image defect from a recordable medium on a surface of which an image is recorded by an image recording part provided with the inkjet head having a plurality of nozzles, and a stamp step of attaching a stamp indicating presence of the image defect on the recordable medium by a stamping device in a case where the image defect is detected, the stamp step differentiating an attachment form of the stamp by the stamping device in accordance with a magnitude of the ejection curve amount of the nozzle.. . ... Fujifilm Corporation

09/21/17 / #20170266964

Inkjet recording apparatus and control method therefor

A control method for an inkjet recording apparatus includes: a head housing step of housing in a head housing part an inkjet head having a nozzle surface on which nozzles configured to eject an ink are formed; a humidity acquiring step of acquiring a relative humidity of the nozzle surface of the inkjet head housed in the head housing part; and a temperature and humidity regulating step of performing at least one of a humidification process and a dehumidification process according to the relative humidity of the nozzle surface acquired in by the humidity acquiring step to set the relative humidity of the nozzle surface to 37% rh or more and 65% rh or less.. . ... Fujifilm Corporation

09/21/17 / #20170265818

Diagnosis support apparatus, operating method, and non-transitory computer readable medium

A diagnosis support apparatus for physiological monitoring includes a data acquisition device for obtaining information of a heartbeat waveform of an examinee. An extractor extracts blood pressure fluctuations based on changes of blood pressure of the examinee from the heartbeat waveform. ... Fujifilm Corporation

09/14/17 / #20170261667

Mirror with image display function

According to the invention, there is provided a mirror with an image display function including, in this order: an image display device; a circular polarization reflection layer; and a front surface plate made of glass or plastic, in which the circular polarization reflection layer includes a cholesteric liquid crystal layer, the cholesteric liquid crystal layer has a central wavelength of selective reflection in a visible light region, and the central wavelength is different from an emission peak wavelength of the image display device by 5 nm or greater. The mirror with an image display function of the invention is capable of displaying a bright image.. ... Fujifilm Corporation

09/14/17 / #20170261666

Mirror with image display function

According to the invention, there is provided a mirror with an image display function including, in this order: an image display device; a ¼ wavelength plate; a circular polarization reflection layer; and a front surface plate made of glass or plastic, in which the circular polarization reflection layer includes a cholesteric liquid crystal layer, and the cholesteric liquid crystal layer has a central wavelength of selective reflection in a visible light region. The mirror with an image display function of the invention is capable of displaying a bright image.. ... Fujifilm Corporation

09/14/17 / #20170261661

Infrared reflective patterned product

Provided is an infrared reflective patterned product including: an infrared reflective pattern portion which includes an infrared reflective material in a region constituting at least a part of a support, in which the infrared reflective pattern portion has an uneven structure that includes a plurality of protruding portions and/or recessed portions, metal particles are contained on surfaces of the protruding portions and/or recessed portions of the uneven structure of the infrared reflective pattern portion, the metal particles include 60 number-percent or greater of tabular metal particles in a hexagonal shape or a circular shape, and the tabular metal particles which are plane-oriented so that an angle between a principal plane of the tabular metal particle and a surface of the uneven structure closest to the tabular metal particle is in a range of 0° to ±30° are adjusted to be 50 number-percent or greater of all tabular metal particles. In the infrared reflective patterned product, the ratio of the reflectance of the infrared reflective pattern portion at a wavelength with the highest reflectance in an infrared region of 780 nm to 2500 nm to the reflectance of a non-pattern portion is large in a case where the infrared reflective pattern portion is obliquely irradiated with infrared rays.. ... Fujifilm Corporation

09/14/17 / #20170260330

Novel polymer and thermosetting composition containing same

This disclosure relates to a polymer that includes a first repeat unit and at least one end-cap group at one end of the polymer. The first repeat unit includes at least one imide moiety and at least one indane-containing moiety. ... Fujifilm Corporation

09/14/17 / #20170259744

Vehicle mirror with image display function

According to the invention, there is provided a vehicle minor with an image display function including, in this order: an image display device; a circular polarization reflection layer; and a front surface plate made of glass or plastic, in which the circular polarization reflection layer includes a linear polarization reflection plate and a ¼ wavelength plate from the image display device side. The vehicle mirror with an image display function of the invention is capable of displaying a bright image.. ... Fujifilm Corporation

09/14/17 / #20170259575

Method for maintenance of liquid discharge head and liquid discharge apparatus

The method includes: a wiping processing step of performing wiping processing on a liquid discharge surface by eccentrically rotating a wiping surface of a wiping member, including raised irregularities on the wiping surface thereof, in a plane parallel to the liquid discharge surface of a liquid discharge head and moving the wiping member in a first direction in a state in which the wiping surface is in contact with the liquid discharge surface; and a post-wiping processing purge processing step of performing post-wiping processing purge processing after the wiping processing step. An eccentric parameter as a value obtained by dividing an eccentric distance of the wiping surface by an interval between the nozzles in a second direction orthogonal to the first direction, is set to 10 or more in the wiping processing step.. ... Fujifilm Corporation

09/14/17 / #20170259229

Advanced fluid processing methods and systems

This disclosure features methods of forming chemical compositions. The method includes (1) mixing a plurality of continuous material flows in a mixing tank to form a chemical composition, each continuous material flow including at least one component of the composition; and (2) moving a continuous flow of the chemical composition to a packaging station downstream of the mixing tank. ... Fujifilm Corporation

09/14/17 / #20170258798

Injection preparation and method for producing same

Provided are an injection preparation which include: an aqueous composition containing pemetrexed or a salt thereof, at least one antioxidant agent which is selected from the group consisting of ascorbic acid, an ascorbic acid derivative, and salts thereof, and the content of which is 0.0001 mass % to 0.5 mass % with respect to the total mass of the aqueous composition in terms of ascorbic acid, and an aqueous solvent of greater than or equal to 50 mass % with respect to the total mass of the aqueous composition; and a container which encloses the aqueous composition, in which the concentration of oxygen in gas within the container which encloses the aqueous composition is less than or equal to 0.2 volume %, and a method for producing the injection preparation.. . ... Fujifilm Corporation

09/14/17 / #20170258393

Image display control apparatus, image display control method, and image display control program

An image display control apparatus includes: an image obtaining unit that obtains an image of a backbone region that includes at least a portion of the backbone of a subject; an emphasized display target region specifying unit that specifies an emphasized display target region within the backbone region based on the image; a bone metastasis region specifying unit that specifies an osteolytic metastasis region included in the backbone region; and a display control unit that causes images to be displayed by a display unit. The display control unit displays an osteolytic metastasis region that belongs within the emphasized display target region with a greater degree of emphasis than an osteolytic metastasis region outside the emphasized display target region.. ... Fujifilm Corporation

09/14/17 / #20170258296

Image processor, image processing method, and endoscope system

An image processor calculates diagnosis support parameters on the basis of the state of blood vessels of an observation object. The image processor includes an image acquisition unit that acquires an endoscopic image, a blood vessel extraction unit that extracts blood vessels, using the endoscopic image, a blood vessel information calculation unit, and a blood vessel parameter calculation unit. ... Fujifilm Corporation

09/07/17 / #20170257581

Imaging device, imaging method, and image processing program

. . . . . . The imaging device includes a multiple-property lens that includes a first area having a first property and a second area having a second property different from the first property, an image sensor in which a first light receiving element 25a having a first microlens and a second light receiving element 25b having a second microlens having a different focusing degree from the first microlens are two-dimensionally arranged, and a crosstalk removal processing unit that removes a crosstalk component from each of a first crosstalk image acquired from the first light receiving element 25a of the image sensor and a second crosstalk image acquired from the second light receiving element to generate a first image and a second image respectively having the first property and the second property of the multiple-property lens.. . ... Fujifilm Corporation

09/07/17 / #20170256364

Photoelectric conversion element, solar cell, and method for manufacturing photoelectric conversion element

A photoelectric conversion element including: a first electrode having a photosensitive layer including a light absorber on a conductive support; a second electrode facing the first electrode; and a hole transport layer provided between the first and the second electrodes, in which the light absorber includes a compound having a perovskite-type crystal structure having a cation of group 1 element of the periodic table or a cationic organic group a, a cation of a metallic atom m that is not group 1 element of the periodic table, and an anion of an anionic atom x, and an organic solvent content per cubic millimeter of the hole transport layer is 1×10−10 to 1×10−7 mol, a solar cell using this photoelectric conversion element, and a method for manufacturing a photoelectric conversion element including a step of applying a hole-transporting material solution and drying the solution at 40° c. To 180° c.. ... Fujifilm Corporation

09/07/17 / #20170256055

Image processing apparatus, operating method, and non-transitory computer readable medium

A region identifier identifies a region within a diagnostic image corresponding to one of plural predetermined clinical findings according to a first feature value from a feature value detector. A level detector performs level detection of the region at one of plural levels associated with the clinical findings for evaluation of the clinical findings according to a second feature value from a feature value detector. ... Fujifilm Corporation

09/07/17 / #20170255825

Image processing apparatus, image processing method, program, and recording medium

In the image processing apparatus, the image processing method, and the recording medium of the invention, an image analysis unit analyzes the contents of each of a plurality of images acquired by an image acquisition unit, and an evaluation value calculation unit calculates an analysis evaluation value of each image based on the analysis result of each image. A group forming unit forms one or more groups, each of which includes a plurality of similar images, by specifying similar images among the plurality of images. ... Fujifilm Corporation

09/07/17 / #20170255100

Dry film structure

This disclosure relates to a dry film structure that includes a carrier substrate, a protective layer, and a polymeric layer between the carrier substrate and the protective layer. The polymeric layer includes at least one protected polybenzoxazole precursor polymer.. ... Fujifilm Corporation

09/07/17 / #20170255098

Positive type resist composition for use in liquid immersion exposure and a method of forming the pattern using the same

A resist composition contains (a) a resin having a monocyclic or polycyclic cycloaliphatic hydrocarbon structure, the resin increasing its solubility in an alkali developer by an action of acid, (b) a compound generating acid upon irradiation with one of an actinic ray and a radiation, (c) particular an alkali soluble compound, and (d) a solvent.. . ... Fujifilm Corporation

09/07/17 / #20170255002

Image pickup optical system and image pickup unit of endoscope, and endoscope

An image pickup optical system of an endoscope includes: a first optical member group that includes an objective optical member disposed closest to a subject side and an image-side optical member that is disposed adjacent to an image side of the objective optical member; a first lens barrel that holds the first optical member group; a second optical member group that is disposed on an image side of the first optical member group; and a second lens barrel that holds the second optical member group, as defined herein.. . ... Fujifilm Corporation

09/07/17 / #20170254990

Imaging lens and imaging apparatus

The imaging lens consists of, in order from an object side: a first lens group g1; a diaphragm; and a second lens group g2 that has a positive refractive power. The first lens group g1 consists of, in order from the object side, a first a lens group g1a that consists of two negative meniscus lenses concave toward an image side, and a first b lens group g1b that consists of only one positive lens or a negative lens and a positive lens. ... Fujifilm Corporation

09/07/17 / #20170254938

Polarizer, polarizing plate, and image display device

The present invention addresses the problem of providing a polarizer maintaining an excellent degree of polarization and having high transmittance and excellent durability, and a polarizing plate and an image display device using the same. This polarizer has a polyvinyl alcohol-based resin and iodine included in the polyvinyl alcohol-based resin, in which the thickness of the polarizer is 2 to 20 μm, the degree of orientation of the polyvinyl alcohol-based resin is 0.11 or more and 0.16 or less, the iodine content is more than 0.50 g/m2 and 1.0 g/m2 or less, and the product of the degree of orientation of the polyvinyl alcohol-based resin and the iodine content is 0.08 g/m2 or more and 0.11 g/m2 or less.. ... Fujifilm Corporation

09/07/17 / #20170253023

Image recording apparatus and parameter setting method

An image recording apparatus includes a recording head, a recording-position information obtaining unit configured to obtain recording position information of a plurality of recording elements a plurality of times at an interval of an arbitrary period, a recording-position chronological change information calculating unit configured to calculate chronological change information of the recording position for each recording element, a medium type specifying unit configured to specify a type of a medium using the chronological change information of the recording position for each recording element, and a parameter setting unit configured to automatically set at least either one of a recording parameter and an abnormality detection parameter in correspondence with the specified type of medium.. . ... Fujifilm Corporation

09/07/17 / #20170252971

Actinic ray-curable-type inkjet ink composition for 3d printing, three-dimensional modeling method, and actinic ray-curable-type inkjet ink set for 3d printing

An actinic ray-curable-type inkjet ink composition for 3d printing includes an acrylate monomer a capable of forming a homopolymer having a glass transition temperature of from 25° c. To 120° c.; an acrylate monomer b capable of forming a homopolymer having a glass transition temperature of −60° or higher and lower than 25° c.; a bifunctional acrylate oligomer c having a weight-average molecular weight of from 2,000 to 20,000; and an acylphosphine oxide compound, in which the mass content of bifunctional or higher-functional acrylate compounds is 15% by mass or less.. ... Fujifilm Corporation

09/07/17 / #20170252467

Multimodal ultrasound and photoacoustic contrast agent based on polymeric microparticles

The invention provides a multimodal ultrasound and photoacoustic contrast agent based on polymeric microparticles having a gas core and carrying at least one photoacoustic agent in its shell that stabilizes the gas core, for use in ultrasound and photoacoustic imaging. Such multimodal ultrasound and photoacoustic contrast agent is also suitable as a carrier of drugs and for use in photodynamic therapy, and for tissue imaging ex vivo.. ... Fujifilm Corporation

09/07/17 / #20170252005

Ultrasonic probe and aligned needle guide system

A side-fire ultrasonic probe includes an alignment feature that, when used to connect the probe with a needle guide for intra-cavity medical procedures, enables alignment of a needle in an imaging plane of an ultrasonic transducer. The alignment feature is configured such that alignment of the needle within the imaging plane is accomplished when a protective sheath is disposed between the alignment feature and the needle guide. ... Fujifilm Corporation

09/07/17 / #20170251932

Processor device for endoscope, operation method thereof, and non-transitory computer readable medium

There is provided a processor device for an endoscope capable of accurately acquiring an observation distance. An endoscope system has an endoscope, and a light source device, and a processor device. ... Fujifilm Corporation

09/07/17 / #20170251914

Endoscope

An endoscope has an imaging unit at a tip portion of an insertion unit to be inserted into a body cavity, and the imaging unit includes: a solid-state imaging device which is disposed in such a manner that a photodetecting surface thereof crosses a longitudinal direction of the insertion unit and which performs photoelectric conversion on an optical image formed on the photodetecting surface; a circuit board having a connection surface which is opposed to a surface, opposite to the photodetecting surface and formed with connection terminals, of the solid-state imaging device and which serves for electrical connection to the connection terminals of the solid-state imaging device, wherein the circuit board is a rigid board that is l-shaped as defined herein; and a first leg and a second leg that constitute the l-shaped circuit board and are perpendicular to each other are provided as defined herein.. . ... Fujifilm Corporation

08/31/17 / #20170251128

Color conversion table creation device and method, program, and recording medium

. . . . A color conversion table creation device includes: an image reading unit that reads a target printed matter and a printed matter printed by a printing device to acquire read image data indicating a read image of each of the target printed matter and the printed matter; a first color conversion unit that converts, using a first color conversion table indicating a correspondence relationship between a signal value in a first color space acquired by the image reading unit and a chromaticity value in a second color space which is a device-independent color space, the signal value in the first color space into the chromaticity value in the second color space; and a second color conversion unit that color-converts document image data into print image data using an input color conversion table and an output color conversion table.. . ... Fujifilm Corporation

08/31/17 / #20170249965

Magnetic tape

The magnetic tape has a magnetic layer containing ferromagnetic powder and binder on one surface of a nonmagnetic support and has a backcoat layer containing nonmagnetic powder and binder on the other surface thereof, wherein the thickness of the backcoat layer is less than or equal to 0.20 μm, and the contact angle for 1-bromonaphthalene that is measured on the surface of the backcoat layer falls within a range of 10.0° to 30.0°.. . ... Fujifilm Corporation

08/31/17 / #20170249964

Magnetic tape

The magnetic tape has a magnetic layer containing ferromagnetic powder and binder on one surface of a nonmagnetic support and has a backcoat layer containing nonmagnetic powder and binder on the other surface thereof, wherein the thickness of the backcoat layer is less than or equal to 0.20 μm, the contact angle for 1-bromonaphthalene that is measured on the surface of the backcoat layer falls within a range of 10.0° to 30.0°, and the contact angle for 1-bromonaphthalene that is measured on the surface of the magnetic layer falls within a range of 45.0° to 55.0°.. . ... Fujifilm Corporation

08/31/17 / #20170249963

Magnetic tape

The magnetic tape has a magnetic layer containing ferromagnetic powder, abrasive, and binder on a nonmagnetic support, wherein the centerline average surface roughness ra measured on the surface of the magnetic layer is less than or equal to 1.8 nm, the contact angle for 1-bromonaphthalene that is measured on the surface of the magnetic layer falls within a range of 45.0° to 60.0°, and the coefficient of friction that is measured on the base portion of the surface of the magnetic layer is less than or equal to 0.35.. . ... Fujifilm Corporation

08/31/17 / #20170249767

System and method for generating a digital image collage

A system and method for generating a digital image collage is provided. The method comprises displaying a user interface comprising a collage template including a layout, and a catalog segment; displaying a plurality of digital images in the catalog segment; generating a first aperture in the layout to establish a first arrangement, and populating the first aperture with the first selected digital image; changing the layout from the first arrangement to a second arrangement, wherein the second arrangement comprises randomly dividing the first aperture into a second aperture and a third aperture, populating the second aperture with the first selected digital image, and populating the third aperture with the second selected digital image thereby generating the digital image collage.. ... Fujifilm Corporation

08/31/17 / #20170248809

Wavelength conversion member, backlight unit including wavelength conversion member, liquid crystal display device, and method of manufacturing wavelength conversion member

The wavelength conversion member includes: a first substrate; a second substrate; and a wavelength conversion layer disposed between the first substrate and the second substrate and including quantum dots which are excited by excitation light to emit fluorescence. The wavelength conversion layer is a cured layer obtained by curing a polymerizable composition which includes the quantum dots and a polymerizable compound having a molecular weight of 200 or lower, and the number of bubble-shaped defects having a diameter of 0.1 mm or more in the wavelength conversion layer is less than 10 per 100 cm2.. ... Fujifilm Corporation

08/31/17 / #20170248780

Endoscope

An endoscope has an imaging unit at a tip portion of an insertion unit to be inserted into a body cavity, the imaging unit includes: a solid-state imaging device which performs photoelectric conversion on an optical image formed on a photodetecting surface thereof; a circuit board having a connection surface which is opposed to a surface, opposite to the photodetecting surface and formed with terminals, of the imaging device and which serves for electrical connection to the terminals; and a case member which covers part of the imaging device and part of the circuit board, the circuit board has a wide portion and a narrow portion that are different in length in a width direction perpendicular to a longitudinal direction of the insertion unit, and the case member is formed with first cuts in such a range as to correspond to the wide portion in the longitudinal direction.. . ... Fujifilm Corporation

08/31/17 / #20170248748

Wavelength conversion member, backlight unit including wavelength conversion member, and liquid crystal display device

A wavelength conversion member includes: a wavelength conversion layer including at least one kind of quantum dots and a gettering agent, the quantum dots being excited by excitation light to emit fluorescence, and the gettering agent trapping at least one of water or oxygen; and a barrier layer having a moisture permeability of 0.1 g/(m2·day·atm) or lower that is formed on at least one surface of the wavelength conversion layer. The wavelength conversion layer is a layer obtained by curing a polymerizable composition including the quantum dots and the gettering agent.. ... Fujifilm Corporation

08/31/17 / #20170248520

Light detection apparatus

First and second filter magazines in each of which plural filters having different transmission wavelengths from each other are arranged in a row are provided, and the first and second filter magazines are arranged next to each other in one direction. A light detection unit in which plural photomultipliers of first and second photomultipliers, each of which detects light that has passed through at least one of the filters included in the first and second filter magazines, are arranged in the arrangement direction of the filters is provided, and the light detection unit is placed in the one direction in such a manner to be parallel to the first and second filter magazines. ... Fujifilm Corporation

08/31/17 / #20170247613

Core-shell particles, method for producing core-shell particles, and film

Provided are core-shell particles that have high luminous efficiency and are useful as quantum dots, a method for producing the same, and a film produced using the core-shell particles. The core-shell particles of the invention are core-shell particles having a core containing a group iii element and a group v element; and a shell covering at least a portion of the surface of the core and containing a group ii element and a group vi element, in which the proportion of the peak intensity ratio of the group ii element with respect to the peak intensity ratio of the group iii element as measured by x-ray photoelectron spectroscopy analysis is 0.25 or higher.. ... Fujifilm Corporation

08/31/17 / #20170247560

Ink image matter generating method

Provided is an ink image matter generating method for selecting a fluorescent ink by performing (a) a process of color-measuring a target color which is a target of color reproduction on a medium and the medium on which an inkjet color ink for color reproduction of the target color is printed; (b) a process of calculating a difference between a colorimetric value of the target color and a colorimetric value of the medium on which the color ink is printed; and (c) a process of selecting a fluorescent ink for reducing the difference between the colorimetric value of the target color and the colorimetric value of the medium on which the color ink is printed, from fluorescent inks that are set in advance, and jetting droplets of the selected fluorescent ink together with the color ink, or after the droplets of the color ink are jetted to cause the fluorescent ink to exist on a surface of an ink image matter, thereby making it possible to select and use an appropriate fluorescent ink with respect to a specific color of which the color reproducibility cannot be ensured using only a color ink in inkjet printing on a medium which is a printing substrate and to ensure high color reproducibility ensuring high color reproducibility for the specific color.. . ... Fujifilm Corporation

08/31/17 / #20170247546

Surface-modified inorganic substance, method for manufacturing surface-modified inorganic substance, method for modifying surface of inorganic substance with organic substance, heat dissipation material, thermally conductive material, and lubricant

The present invention provides a novel surface-modified inorganic substance obtained by modifying the surface of an inorganic nitride or an inorganic oxide with a boronic acid compound, and a heat dissipation material, a thermally conductive material, and a lubricant which use the surface-modified inorganic substance. The present invention also provides a method for manufacturing the surface-modified inorganic substance, and provides, as a novel method for modifying the surface of an inorganic substance selected from an inorganic oxide and an inorganic nitride with an organic substance, a method for modifying the surface of an inorganic nitride or an inorganic oxide with an organic substance that includes making a contact between the inorganic nitride or the inorganic oxide with a boronic acid compound.. ... Fujifilm Corporation

08/31/17 / #20170247544

Coloring composition for textile printing, textile printing method, ink for ink jet textile printing, and dyed fabric

Provided are: a coloring composition for dyeing including a compound represented by formula (1) shown in this specification or a salt thereof; a coloring composition for textile printing in which the coloring composition for dyeing is used for textile printing; a compound which is preferable as a material of the coloring compositions; a textile printing method in which the above-described coloring composition for textile printing is used; an ink for ink jet textile printing including the above-described coloring composition for textile printing; and a dyed fabric.. . ... Fujifilm Corporation

08/31/17 / #20170246865

Method for adjusting recording head, and image forming apparatus

When discharge timing of a first head module and a second head module, adjacent to each other, is adjusted in a recording head in which a plurality of head modules each having s nozzle array in which a plurality of nozzles is arranged in different positions in a first direction is joined in a second direction intersecting with the first direction, the discharge timing is adjusted so that a complementary region recording shift amount being a recording shift amount in the first direction in a complementary region in a joined portion between the first head module and the second head module becomes a value between a first non-complementary region recording shift amount and a second non-complementary region recording shift amount that are recording shift amounts in the first direction in respective non-complementary regions in the first head module and the second head module.. . ... Fujifilm Corporation

08/31/17 / #20170246853

Printing apparatus and printing method

A printing apparatus applies ink to a surface of a printing plate in the shape of a predetermined pattern and then transfers the ink to a substrate. The printing apparatus includes: an image recording section that applies the ink to the surface of the printing plate; a plate surface observation unit that acquires information about the surface of the printing plate; a storage section that stores information about a reference shape serving as a reference of the surface of the printing plate; and a determination section that compares the information about the reference shape stored in the storage section with the information about the surface of the printing plate, which is obtained by the plate surface observation unit, and determines whether or not the surface of the printing plate to which the ink has been applied is present in a predetermined range of the reference shape.. ... Fujifilm Corporation

08/31/17 / #20170245823

Medical imaging device, tube voltage setting device, imaging control method, and recording medium storing imaging control program

A medical imaging device that includes: a press plate that presses a breast; an emitter that radiates radiation onto the breast; an acquisition section that acquires various information indicating a type of an acoustic matching member inserted between the press plate and the breast in cases in which ultrasound imaging of the breast is performed; and a setting section that sets a tube voltage of the emitter to a first tube voltage, in cases in which radiographic imaging of the breast is performed alone, and that sets the tube voltage of the emitter to a second tube voltage that is different from the first tube voltage, by employing the various information acquired by the acquisition section, in cases in which radiographic imaging and ultrasound imaging of the breast are performed consecutively with the acoustic matching member still inserted.. . ... Fujifilm Corporation

08/31/17 / #20170245820

Evaluation apparatus, evaluation method, and evaluation program

A first extracting unit extracts at least one portion of a region of a target structure that includes lumen structures having branches from a three dimensional image of the target structure. A second extracting unit extracts the lumen structures from the at least one portion of the region of the target region. ... Fujifilm Corporation

08/24/17 / #20170244901

Imaging apparatus and image blur correction method

An imaging apparatus includes: a driving unit that moves a focus lens; a focusing unit that determines a focus state and outputs a focusing signal indicating a focus position of the focus lens; a control unit that controls the driving unit based on the focusing signal; an acceleration detection unit that detects acceleration in directions of three orthogonal axes; a distance calculation unit that calculates an acceleration component in an optical axis direction based on the acceleration in the directions of the three orthogonal axes detected by the acceleration detection unit and calculates an object distance corresponding to the focus position indicated by the focusing signal based on the acceleration component in the optical axis direction; and a shake correction unit that corrects an image blur caused by a translational shake in directions of two orthogonal axes perpendicular to at least an optical axis as defined herein.. . ... Fujifilm Corporation

08/24/17 / #20170244900

Imaging apparatus and imaging method

An imaging apparatus includes: a distance detection unit that detects an object distance; a shake detection unit that detects an amount of shake of the imaging apparatus; a driving unit that moves an optical element or an imaging element included in an imaging optical system to correct an image blur caused by a shake of the imaging apparatus; and a control unit that calculates an amount of movement of the optical element or the imaging element moved by the driving unit based on the amount of shake detected by the shake detection unit and controls the driving unit, and the control unit directs the imaging element to continuously capture images in response to an imaging instruction and changes a correction gain which is used to calculate the amount of movement for each imaging operation, depending on the object distance detected by the distance detection unit.. . ... Fujifilm Corporation

08/24/17 / #20170244889

Focusing control device, focusing control method, focusing control program, lens device, and imaging device

Disclosed are a focusing control device which performs focusing control by a phase difference af method with high accuracy, a lens device, an imaging device, a focusing control method, and a non-transitory computer readable recording medium storing a program. A digital camera includes a phase difference calculation unit which calculates the phase difference between a signal group output from a plurality of pixels 52a and a signal group output from a plurality of pixels 52b, a lens drive control unit which drives a focus lens according to a drive amount corresponding to the phase difference, a phase difference prediction unit which, based on a coefficient for converting a phase difference calculated at an arbitrary time to a drive amount and the difference between a movement amount of the focus lens and the drive amount, calculates a predicted value of the phase difference.. ... Fujifilm Corporation

08/24/17 / #20170243379

Tomographic image generation device, radiography imaging system, tomographic image generation method and tomographic image generation program storage medium

A tomographic image generation device includes a projection image acquisition section configured to acquire plural projection images obtained by radiating radiation onto a breast in sequence from plural radiation angles and by performing imaging at each of the plural radiation angles; a mammary gland density acquisition section configured to acquire a mammary gland density of the breast; a derivation section configured to derive a slice thickness that decreases as the mammary gland density acquired by the mammary gland density acquisition section increases; and a generation section configured to generate a tomographic image at the slice thickness derived by the derivation section based on the plural projection images acquired by the projection image acquisition section.. . ... Fujifilm Corporation

08/24/17 / #20170243342

Conductive film, display device having the same, and method of evaluating conductive film

A conductive film has a polygonal wiring pattern which allows an indicator of evaluation of noises to be equal to or less than an evaluation threshold value. Here, from at least one point of view, in frequencies and intensities of noises each calculated for each color from first and second peak frequencies and first and second peak intensities of 2dfft spectra of transmittance image data of a combined wiring pattern including a random mesh pattern of a plurality of thin metal lines of a wiring portion and luminance image data of a pixel array pattern of each color at the time of lighting on for each single color, the indicator of evaluation of noise is calculated from evaluation values of noises of the respective colors obtained by applying human visual response characteristics in accordance with an observation distance to intensities of the noises equal to or greater than a first intensity threshold value among intensities of the noises at frequencies of noises equal to or less than a frequency threshold value defined by a display resolution of a display unit.. ... Fujifilm Corporation

08/24/17 / #20170242511

Conductive sheet and conductive sheet for touch panel

A conductive sheet, method for using conductive sheet and touch panel, having a base substance and conductive parts formed on one of the principal surfaces of the base substance. The conductive parts respectively extend in primary directions, and have two or more conductive patterns made from metal wires arranged in a second direction that is perpendicular to the first direction. ... Fujifilm Corporation

08/24/17 / #20170242338

Active-light-sensitive or radiation-sensitive resin composition, active-light-sensitive or radiation-sensitive film, pattern forming method, and method for manufacturing electronic device

Provided are an active-light-sensitive or radiation-sensitive resin composition in which the sensitivity is excellent, and an active-light-sensitive or radiation-sensitive film, a pattern forming method, and a method for manufacturing an electronic device, each using the active-light-sensitive or radiation-sensitive resin composition. The active-light-sensitive or radiation-sensitive resin composition contains a resin (ab) whose polarity is changed by the action of an acid, and a compound that generates an acid upon irradiation with active light or radiation, in which the resin (ab) includes a metal ion, and the metal type of the metal ion is at least one of metal types belonging to groups 1 to 10 and 13 to 16 (here, excluding mg and cs).. ... Fujifilm Corporation

08/24/17 / #20170242324

Projector

A projector 10 includes an image forming panel 14 on which an image is formed, and a projection lens 15 which projects the image of the image forming panel 14 onto a screen 20. The center of the image forming panel 14 is fixed with being shifted in a direction opposite to a direction, in which a central position of a projection surface of the screen 20 is deviated with respect to an optical axis l of the projection lens 15. ... Fujifilm Corporation

08/24/17 / #20170242246

Head up display apparatus and image display apparatus

An image display apparatus mounted in a head up display apparatus includes: an image display element that outputs display light; a diffusing member that receives the display light at a light receiving surface and outputs the display light as diffused light from a light output surface; and a light deflecting means that deflects the display light output from the image display element, provided between the image display element and the diffusing member. An image display surface of the image display element and the light output surface of the diffusing member are parallel, and the image display element, the diffusing member, and the light deflecting means are arranged in a state such that a line normal to the light output surface of the diffusing member is inclined with respect to the optical axis of the display light after being deflected by the light deflecting means.. ... Fujifilm Corporation

08/24/17 / #20170242222

Imaging lens and imaging apparatus

The imaging lens includes, in order from the object side, a first lens group that remains stationary during focusing; a diaphragm; and a positive second lens group that moves to the object side during focusing from a long range to a close range. The second lens group includes a positive z lens that is formed continuously in order from a most image side, a negative y lens that has an absolute value of a radius of curvature of an object side surface smaller than an absolute value of a radius of curvature of an image side surface, a positive x lens, and a negative w lens that has an absolute value of a radius of curvature of an image side surface smaller than that of an object side surface. ... Fujifilm Corporation

08/24/17 / #20170242221

Imaging lens and imaging apparatus

The imaging lens includes, in order from the object side, a first lens group that remains stationary during focusing; a diaphragm; and a positive second lens group that moves to the object side during focusing from a long range to a close range. The first lens group includes, in order from the object side: a negative meniscus lens that has an absolute value of a radius of curvature of an image side surface smaller than that of an object side surface, a negative lens, a positive lens, and a negative lens. ... Fujifilm Corporation

08/24/17 / #20170242219

Imaging lens and imaging apparatus

The imaging lens consists of, in order from the object side, a first lens group g1 having a positive power, a diaphragm, a second lens group g2 having a positive power, and a third lens group g3. Each of the lens groups includes three or more lenses. ... Fujifilm Corporation

08/24/17 / #20170242213

Projector

A projector includes an image forming panel 14 on which an image is formed, and a projection lens 15 which projects the image of the image forming panel 14. In a projector in which the center of the image forming panel 14 is fixed with being shifted in a direction opposite to a direction in which a central position of the projected image of the image forming panel 14 is deviated with respect to an optical axis l of the projection lens 15, a lens barrel 31 of the projection lens 15 includes heater 33 for heating a lens barrel portion on a side opposite to a direction, in which the image forming panel 14 is shifted, on the image forming panel 14 side from the diaphragm position 32 where an f-number of the projection lens is determined. ... Fujifilm Corporation

08/24/17 / #20170242179

Wavelength conversion member, backlight unit including wavelength conversion member, and liquid crystal display device

The wavelength conversion member includes: a wavelength conversion layer obtained by curing a polymerizable composition including quantum dots that emit fluorescence when excited by excitation light; a barrier layer having a moisture permeability of 0.1 g/(m2·day·atm) or lower that is formed over at least one surface of the wavelength conversion layer; and at least one intermediate layer that is interposed between the wavelength conversion layer and the barrier layer. The at least one intermediate layer includes a gettering agent-containing layer that includes a gettering agent for trapping at least one of water or oxygen.. ... Fujifilm Corporation

08/24/17 / #20170242175

Retardation film, composition, method of manufacturing retardation film, polarizing plate and liquid crystal display device

An object of the present invention is to provide a film capable of giving a necessary retardation without degrading the contrast. The present invention provides a retardation film formed from a composition which includes a polymer compound, a rod-like liquid crystal compound and a photo-reactive compound, wherein the polymer compound has a side chain which has one or more azo groups and/or cynnamate groups, and 3 or more and 10 or less arylene groups; the side chain further has an optionally substituted amino group, or a hydrocarbon group at the terminal; an absolute value of difference between an sp value of the polymer compound and an sp value of the photo-reactive compound is 1.1 or less; and an in-plane retardation of the film at wavelength of 550 nm is 10 nm or more and 200 nm or less.. ... Fujifilm Corporation

08/24/17 / #20170242112

Ultrasound transducer with data compression

A transducer for an ultrasound imaging system includes an array of transducer elements and an analog-to-digital converter configured to convert analog signals produced by the transducer elements into corresponding digital samples that are encoded with a first number of bits. One or more memories are used to store digital samples associated with frames of ultrasound data. ... Fujifilm Corporation

08/24/17 / #20170241909

Imaging apparatus and method

A subject-to-be-examined support unit that supports a subject to be examined, a light source unit that outputs light entering the subject-to-be-examined support unit from a side opposite to a side by which a sample is supported, a fluorescent plate that is illuminated with the light that has been output from the light source unit and passed through the subject-to-be-examined support unit and the sample, and emits fluorescence, a photomultiplier that detects fluorescence that has been emitted from the fluorescent plate and passed through the subject-to-be-examined support unit and the sample, and a plate support unit that supports the fluorescent plate are provided. The plate support unit is structured in such a manner that a distance between the subject-to-be-examined support unit and the fluorescent plate is changeable by moving the fluorescent plate in a direction closer to the subject-to-be-examined support unit and in a direction away therefrom.. ... Fujifilm Corporation

08/24/17 / #20170240943

Expression system

A perfect palindrome operator sequence-based protein expression system is provided. The expression system comprises a promoter; and a perfect palindrome operator sequence, wherein the promoter is not t7. ... Fujifilm Corporation

08/17/17 / #20170237967

Imaging device, imaging method, and image processing program

. . . . The imaging device includes a multiple-property lens that includes a first area having a first property and a second area having a second property different from the first property, an image sensor in which a first light receiving element 25a having a first microlens and a second light receiving element 25b having a second microlens having a different image forming magnification from the first microlens are two-dimensionally arranged, and a crosstalk removal processing unit that removes a crosstalk component from each of a first crosstalk image acquired from the first light receiving element 25a of the image sensor and a second crosstalk image acquired from the second light receiving element to generate a first image and a second image respectively having the first property and the second property of the multiple-property lens.. . ... Fujifilm Corporation

08/17/17 / #20170237895

Focusing control device, focusing control method, focusing control program, lens device, and imaging device

A focusing control device includes a phase difference calculation unit 11a which calculates the phase difference between a signal group output from a plurality of pixels 52a for phase difference detection and a signal group output from a plurality of pixels 52b for phase difference detection, a lens drive control unit 11c which drives a focus lens according to a drive amount corresponding to the phase difference, and a phase difference prediction unit 11b which calculates a predicted value of a phase difference at a time t(n+1) based on a coefficient a(n) for converting a phase difference calculated at a time t(n) to a drive amount and the difference Δm(n+1) between a movement amount of the focus lens from the time t(n) at the time t(n+1) after the focus lens starts to move according to the drive amount and the drive amount.. . ... Fujifilm Corporation

08/17/17 / #20170237115

All-solid-state secondary battery, solid electrolyte composition and electrode sheet for batteries used in the same, and manufacturing method of electrode sheet for batteries and all-solid-state secondary battery

An all-solid-state secondary battery includes a positive electrode active substance layer; a negative electrode active substance layer; and an inorganic solid electrolyte layer, in which at least one of the positive electrode active substance layer, the negative electrode active substance layer, or the inorganic solid electrolyte layer contains an inorganic solid electrolyte having conductivity of ions of metal belonging to group 1 or 2 of the periodic table and a cellulose polymer.. . ... Fujifilm Corporation

08/17/17 / #20170237114

All-solid-state secondary battery, solid electrolyte composition and electrode sheet for batteries used in the same, and manufacturing method of electrode sheet for batteries and all-solid-state secondary battery

An all-solid-state secondary battery includes: a positive electrode active substance layer; a negative electrode active substance layer; and a solid electrolyte layer, in which at least one layer of the positive electrode active substance layer, the negative electrode active substance layer, or the solid electrolyte layer contains a nitrogen-containing polymer having a repeating unit having at least one of a substituent x, a substituent y, or a substituent z and an inorganic solid electrolyte having conductivity of ions of metal belonging to group 1 or 2 in the periodic table.. . ... Fujifilm Corporation

08/17/17 / #20170236276

Radiation image processing apparatus, radiation image processing method, and recording medium having radiation image processing program stored therein

First and second image obtaining units respectively obtain a plurality of first projection images and a plurality of second projection images by tomosynthesis imaging operations according to first and second imaging conditions. A reconstructing unit reconstructs the plurality of first and second projection images employing processes of a reconstruction process that includes a filtering process other than the filtering process, to generate a plurality of first tomographic images and a plurality of second tomographic images for each of a plurality of cross sectional planes within a subject. ... Fujifilm Corporation

08/17/17 / #20170232718

Functional laminated film

Provided is a functional laminated film having a functional layer formed by dispersing functional materials in a binder, in which the functional laminated film can inhibit generation of bubbles in the functional layer, and can prevent the functional material from being deteriorated by water or oxygen. The functional layer is formed by dispersing functional materials in a binder, and the binder is formed by polymerizing monomers. ... Fujifilm Corporation

08/17/17 / #20170231593

Radiation image processing apparatus, radiation image processing method, and recording medium having radiation image processing program stored therein

A first imaging unit obtains a first radiation image, which is imaged under first imaging conditions. A second imaging unit obtains a plurality of projection images by tomosynthesis imaging under second imaging conditions. ... Fujifilm Corporation

08/17/17 / #20170231469

Processor device for endoscope,operation method thereof, and non-transitory computer readable medium

There is provided a processor device for an endoscope capable of acquiring a blood vessel index value of a specific observation distance used for predetermined diagnostic criteria. A distance acquisition unit acquires a non-magnified observation distance at the start of the change of the imaging magnification, and acquires magnified observation distance at the end of the change of the imaging magnification. ... Fujifilm Corporation

08/10/17 / #20170230632

Time series data display control device, method for operating the same, program, and system

. . . . . . . . . . . . . . . . . . A main display region 41 in which medical care data on a plurality of items is displayed is provided on the display screen 15. The main display region 41 may be displayed in two display modes of a two-dimensional display mode and a three-dimensional display mode in which a two-dimensional plane on which time series data is displayed is three-dimensionally displayed using the laws of perspective. ... Fujifilm Corporation

08/10/17 / #20170230595

Imaging device, imaging method, and image processing program

The imaging device includes a multiple-property lens that includes a first area having a first property and a second area having a second property different from the first property, an image sensor in which a first light receiving element 25a and a second light receiving element 25b having a different opening size of a light receiving section from the first light receiving element 25a are two-dimensionally arranged, and a crosstalk removal processing unit that removes a crosstalk component from each of a first crosstalk image acquired from the first light receiving element 25a of the image sensor and a second crosstalk image acquired from the second light receiving element to generate a first image and a second image respectively having the first property and the second property of the multiple-property lens.. . ... Fujifilm Corporation

08/10/17 / #20170230594

Imaging device and control method therefor

The type of lens attached to the lens attaching portion is determined. In a case of the multiple-property lens being attached to the lens attaching portion, a plurality of images corresponding to the plurality of areas is generated. ... Fujifilm Corporation

08/10/17 / #20170229830

Solid-state laser device and photoacoustic measurement device

In a solid-state laser device and a photoacoustic measurement device including the solid-state laser device, the distance between a laser rod and a flash lamp is narrowed. A shielding lid shields mirrors and an optical path of laser light from the outside. ... Fujifilm Corporation

08/10/17 / #20170228900

Time series data display control device, method for operating the same, program, and system

A main display region 41 in which medical care data on a plurality of items is displayed is provided on a display screen 15. The main display region 41 may be displayed in two display modes of a two-dimensional display mode and a three-dimensional display mode in which a time scale is longer than a time axis of the two-dimensional display mode and a two-dimensional plane on which time series data is displayed is three-dimensionally displayed using the laws of perspective by which a plurality of straight lines parallel to the time axis in the two-dimensional display mode are drawn to be converged toward the past on the time axis.. ... Fujifilm Corporation

08/10/17 / #20170228877

Device and method for image registration, and a nontransitory recording medium

A first registration unit performs first registration between a live view and an associated image associated with an object to be imaged. A second registration unit performs second registration between the object captured in the live view and the associated image based on the result of the first registration. ... Fujifilm Corporation

08/10/17 / #20170228090

Conductive film and touch panel sensor provided with same

The conductive film is configured such that in a case in which a parameter ca of a first-overlapped-portion in which a thin metal wire constituting a first-electrode and a thin metal wire constituting a second-electrode are superimposed in plan view is represented by equation (1) of ca=(a−wa*wb)/d, while setting an area of the first-overlapped-portion to a (μm2), line widths of the respective thin metal wires constituting the first-electrode and the second-electrode to wa and wb (μm), and a distance between the first-electrode and the second-electrode in a thickness direction of a substrate to d (μm), in a 5 mm×5 mm quadrangular region that is set to include a crossing region in which the first-electrode and the second-electrode cross each other in a conductive region, the parameter ca of 90% or more of the first-overlapped-portions included in the region is 1.0 or less.. . ... Fujifilm Corporation

08/10/17 / #20170228052

Conductive film and touch panel sensor provided with same

A conductive film is configured such that a plurality of first cells constituted by thin metal wires crossing each edge line on both sides of a preset electrode shape of a conduction electrode extending in one direction have a disconnection portion at a position where the thin metal wires and the edge lines cross one another with the exception of a plurality of third cells in a closed state of which the number proportion is 50% or more of a plurality of second cells in which all apexes constituting a cell on an inner side of an extended edge line separated by a fixed distance from the edge line to an outer side, and the apexes of the plurality of third cells present between the adjacent edge line and extended edge line are end points, or the thin metal wires extending from the apex directly to the extended edge line have a disconnection portion.. . ... Fujifilm Corporation

08/10/17 / #20170227746

Imaging lens and imaging apparatus

An imaging lens is constituted by, in order from the object side to the image side: a first lens group; a stop; and a second lens group having a positive refractive power. The first lens group is constituted by, in order from the object side to the image side: one or two negative meniscus lenses, a biconcave lens, and a biconvex lens. ... Fujifilm Corporation

08/10/17 / #20170227745

Imaging lens and imaging apparatus

An imaging lens is constituted by, in order from the object side to the image side: a first lens group; a stop; and a second lens group having a positive refractive power. The first lens group is constituted by, in order from the object side to the image side: a 1-1 negative meniscus lens having a concave surface toward the image side; a 1-2 negative meniscus lens having a concave surface toward the image side; a 1-3 biconcave lens; and a 1-4 positive lens. ... Fujifilm Corporation

08/10/17 / #20170227693

Optical member and image display device

An optical member and an image display device including an optical member having a support, an underlayer, and a wavelength selective reflection portion in this order, in which the wavelength selective reflection portion has wavelength selective reflecting properties, the wavelength selective reflection portion has a cholesteric structure which has a stripe pattern including bright portions and dark portions in a cross-sectional view of the wavelength selective reflection portion when observed with a scanning electron microscope, the underlayer absorbs invisible light, and a wavelength range where the wavelength selective reflection portion has wavelength selective reflecting properties overlaps a wavelength range of invisible light absorbed by the underlayer. In the optical member, a signal/noise ratio is high which is a ratio of a reflectance of the wavelength selective reflection portion to a reflectance of the underlayer in a wavelength range where the wavelength selective reflection portion has wavelength selective reflecting properties.. ... Fujifilm Corporation

08/10/17 / #20170227692

Optical member and image display device including optical member

The optical member of the present invention includes: a substrate; and a dot that is in contact with a surface of the substrate, in which the dot has wavelength selective reflecting properties, the dot is formed of a liquid crystal material having a cholesteric structure, the cholesteric structure has a stripe pattern including bright portions and dark portions in a cross-sectional view of the dot when observed with a scanning electron microscope, the dot includes a portion having a height which continuously increases to a maximum height in a direction moving from an end portion of the dot to the center of the dot, in the portion, an angle between a normal line perpendicular to a line, which is firmed using a first dark portion from a surface of the dot, and the surface is in a range of 70° to 90°, and the liquid crystal material includes a surfactant.. . ... Fujifilm Corporation

08/10/17 / #20170227690

Near infrared ray absorbent composition, near infrared ray cut filter, solid image pickup element, and camera module

Provided are a near infrared ray absorbent composition which can form a cured film having excellent near infrared ray shielding properties, a near infrared ray cut filter, a manufacturing method of a near infrared ray cut filter, a solid image pickup element, and a camera module. The near infrared ray absorbent composition includes a copper complex that is other than a copper phthalocyanine complex and has a maximum absorption wavelength in a wavelength range of 700 to 1,200 nm and in which a molar light absorption coefficient at the maximum absorption wavelength is greater than or equal to 100 (l/mol·cm).. ... Fujifilm Corporation

08/10/17 / #20170225471

Liquid ejection device and cleaning method

When a liquid ejection head and a first wiping unit are moved relatively to clean a surface, the first wiping unit making a first wiping member travel in a first direction, a direction opposite to the first direction is used as a moving direction of the head with reference to the first wiping member in relative moving therebetween. When the head and a second wiping unit are moved relatively to each other to clean the surface, the second wiping unit making a second wiping member travel in a second direction having a component of a direction opposite to the first direction, a direction opposite to the second direction is used as a moving direction of the head with reference to the second wiping member in relative moving therebetween to move the second wiping unit and the head relatively to clean the same area on the surface.. ... Fujifilm Corporation

08/10/17 / #20170224306

High frequency ultrasound probe

A high frequency ultrasound probe includes a substrate having a number of transducer elements on it and a ground plane that is electrically coupled by one or more vias to a conductive frame that supports the substrate. The conductive frame is electrically coupled to a ground plane of a printed circuit having conductors that are coupled to the transducer elements.. ... Fujifilm Corporation

08/10/17 / #20170224219

Light penetration depth evaluation method, performance test method using evaluation method, and optical tomography apparatus

Using an optical tomography method of splitting low coherent light into sample light and reference-light, emitting the sample light to a measurement-target in a line shape, generating interference light by superimposing reflected light from the measurement-target due to emission of the sample light and the reference-light on each other, and acquiring a two-dimensional spectroscopic tomographic-image of the measurement-target by spectroscopically detecting the interference light and performing frequency analysis, an arbitrary wavelength region in an ultraviolet region is cut out from low coherent light including a wavelength region from an ultraviolet region to a visible region and the arbitrary wavelength region is shaped into a spectrum having an arbitrary wavelength width, the two-dimensional spectroscopic tomographic-image is acquired as using the low coherent light, and the penetration depth of the sample light for the measurement-target is evaluated based on the two-dimensional spectroscopic tomographic-image.. . ... Fujifilm Corporation

08/10/17 / #20170224201

Objective lens for endoscopes and endoscope

The number of lenses within an objective lens for endoscopes is only three. The objective lens for endoscopes includes, in order from the object side, a first lens which is a single lens having a negative refractive power and a concave surface toward the object side, an aperture stop, and a cemented lens. ... Fujifilm Corporation

08/10/17 / #20170224196

Medical drive device

An object is to detect the pressing force of a tip driven unit. In the controller 22, a motor control circuit 85, a load change detection unit 86, a moving speed calculation unit 87 that calculates the moving speed of a rotating body 41, a pressing force detection unit 88 that obtains the pressing force of the rotating body 41 based on the moving speed which is calculated, a cpu 89, and an alarm 91 are disposed. ... Fujifilm Corporation

08/03/17 / #20170222138

Ruthenium removal composition and method of producing magnetoresistive random access memory

An object is to provide a ruthenium removal composition capable of dissolving ru while suppressing dissolution of cofeb, and a method of producing a magnetoresistive random access memory (mram) using the same. A ruthenium removal composition of the present invention contains orthoperiodic acid and water, and the ph is 11 or more. ... Fujifilm Corporation

08/03/17 / #20170221517

Magnetic tape and method of manufacturing the same

The magnetic tape has a magnetic layer and a backcoat layer, wherein, each of the magnetic layer and backcoat layer contains a fatty acid ester, the ra measured on the magnetic layer side surface is less than or equal to 2.8 nm, the difference between the spacing measured by optical interferometry on the magnetic layer side surface after and before vacuum heating is greater than 0 nm but less than or equal to 8.0 nm, the fwhmbefore on the backcoat layer side surface is greater than 0 nm but less than or equal to 10.0 nm, the fwhmafter on the backcoat layer side surface is greater than 0 nm but less than or equal to 10.0 nm; and the difference between the spacing measured on the backcoat layer side surface after and before vacuum heating is greater than 0 nm but less than or equal to 8.0 nm.. . ... Fujifilm Corporation

08/03/17 / #20170221516

Magnetic tape and method of manufacturing the same

The magnetic tape has a magnetic layer and a backcoat layer, wherein the ra on the magnetic layer side surface is less than or equal to 1.8 nm, the coefficient of friction measured on the base portion of the magnetic layer side surface is less than or equal to 0.35, the ra measured on the backcoat layer side surface is less than or equal to 5.0 nm, the backcoat layer contains a fatty acid ester, the fwhmbefore measured on the backcoat layer side surface before vacuum heating is greater than 0 nm but less than or equal to 10.0 nm, the fwhmafter after vacuum heating is greater than 0 nm but less than or equal to 10.0 nm, and the difference between the spacing measured on the backcoat layer side surface after and before vacuum heating is greater than 0 nm but less than or equal to 8.0 nm.. . ... Fujifilm Corporation

08/03/17 / #20170221207

Radiation image processing device, radiation image processing method and program

It is possible to allow image processing on a radiation image such that the same effect of scattered radiation elimination as when imaging is actually performed using a grid is obtained. When performing processing for eliminating scattered radiation included in radiation transmitted through a subject m on a radiation image imaged by irradiating the subject m with radiation, a characteristic acquisition unit 32 acquires a virtual grid characteristic as a characteristic of a virtual grid assumed to be used to eliminate scattered radiation at the time of imaging of the radiation image. ... Fujifilm Corporation

08/03/17 / #20170221196

Conductive film, display device having the same, and method of evaluating wiring patterns of conductive film

A conductive film is provided on the display unit such that the wiring patterns of the two wiring portions overlap with the pixel array patterns of the display unit. A projected wiring pattern, which is obtained when the wiring patterns of the two wiring portions having three-dimensional shapes are projected onto a plane perpendicular to a point of view, includes a regular wiring pattern which has a mesh shape, or an irregular wiring pattern which has mesh shapes and which is formed by making the regular wiring pattern irregular. ... Fujifilm Corporation

08/03/17 / #20170221195

Conductive film, display device having the same, and method of evaluating conductive film

In the conductive film, a plurality of thin metal lines has a wavy wiring pattern in which a plurality of thin metal lines is formed as wavy lines, of which amplitudes are equal to or less than an amplitude threshold value, so as to have irregularity. The plurality of thin metal lines constitutes a typical wiring pattern which allows an indicator of evaluation of moirés to be equal to or less than an evaluation threshold value. ... Fujifilm Corporation

08/03/17 / #20170220748

Medical support apparatus and system, and non-transitory computer readable medium

A medical support apparatus includes a first acquisition unit for acquiring activity log data of a user activity related to a test result from a display terminal apparatus for displaying a test result of a diagnostic test performed to a patient body. A second acquisition unit acquires message data of a message transmitted between medical user terminal apparatuses from the medical user terminal apparatuses used by medical workers, such as a doctor. ... Fujifilm Corporation

08/03/17 / #20170220154

Transfer film, method for manufacturing same, method for manufacturing laminate, method for manufacturing capacitance-type input device, and method for manufacturing image display device

The transfer film includes a temporary support, a resin layer, and a cover film in this order, in which when the cover film is peeled from the resin layer, a surface of the cover film that contacted the resin layer has surface roughnesses srz and sra of equal to or less than 130 nm and equal to or less than 8 nm respectively that are measured based on jis-b0601-2001.. . ... Fujifilm Corporation

08/03/17 / #20170219820

Imaging lens and imaging apparatus

Provided are an imaging lens and an imaging apparatus which includes this imaging lens. The imaging lens consists of, in order from an object side: a front group gf; a diaphragm st; and a rear group gr. ... Fujifilm Corporation

08/03/17 / #20170219819

Optical element and method of manufacturing optical element

An optical element includes: an optical element substrate; a first light shielding film that covers a non-optical path portion of the optical element substrate; a functional film that covers an optical path portion of the optical element substrate and the first light shielding film; and a second light shielding film that covers a non-optical path portion of the functional film, in which a region of the functional film which is not covered with the second light shielding film is transparent and has a uneven structure, and a region of the functional film which is covered with the second light shielding film has light reflecting properties. As a result, the optical element such as a lens is provided in which flare characteristics are excellent, and ghosting does not occur.. ... Fujifilm Corporation

08/03/17 / #20170217231

Fluid ejection module mounting

A fluid ejection module mounting apparatus, including a module mount having a horizontal portion and a vertical portion, a fluid ejection module mounted to the module mount, and a clamp assembly including a recessed portion, a clamp along a wall of the recessed portion, and a lever coupled to the clamp and configured to move the clamp from an open position to a closed position. The horizontal portion has an opening configured to receive a fluid ejection module and the vertical portion has a protruding portion. ... Fujifilm Corporation

08/03/17 / #20170217060

Method for manufacturing reel

A method for manufacturing a reel includes molding a reel configuration component that is made of resin and includes a reel hub with an outer peripheral face for winding a recording tape onto, after the molding and prior to the reel configuration component cooling and shrinking, embedding a reinforcement ring into the reel hub, and after the embedding, cooling and shrinking the reel configuration component and fixing the reinforcement ring to the reel hub.. . ... Fujifilm Corporation

08/03/17 / #20170215828

Radiological image radiographing display method and system thereof

Targeting of a lesion which is performed by a stereoscopic biopsy device or the like is performed simply and highly accurately. Designation of a predetermined position in the stereoscopic image is received to acquire position information when a stereoscopic image is displayed, radiological images of radiographing directions are displayed as two-dimensional images, a mark based on the position information, which is designated in the stereoscopic image, is displayed in the two-dimensional images, designation of a predetermined position in the two-dimensional images is further received to acquire the position information after the mark is displayed.. ... Fujifilm Corporation

08/03/17 / #20170215754

Methods and apparatus for enhanced fiducial point determination and non-invasive hemodynamic parameter determination

Methods and apparatus for utilizing multiple sources of physiologic data to enhance measurement robustness and accuracy. In one embodiment, phonocardiography or “heart sounds” data is used in combination with one or more other techniques (for example, impedance cardiography or icg waveforms, and/or electrocardiography or ecg waveforms) to provide more accurate and robust physiological and/or hemodynamic assessment of living subjects. ... Fujifilm Corporation

07/27/17 / #20170214059

Aluminum plate and method for manufacturing aluminum plate

. . An object is to provide an aluminum plate having favorable coating properties and favorable adhesiveness to active materials and a method for manufacturing an aluminum plate. The aluminum plate having a plurality of through holes that penetrate in a thickness direction includes through holes a which have an average opening diameter of the through holes of 0.1 μm or more and less than 100 μm and have a shape in which a maximum diameter ra is formed inside and the maximum diameter ra and a minimum diameter rb satisfy 1>rb/ra≧0.1.. ... Fujifilm Corporation

07/27/17 / #20170212346

Head up display apparatus

A head up display apparatus includes: a first mirror having power; a second mirror having power; and a light shielding member provided with an aperture. The aperture is provided between an image display surface and the second mirror. ... Fujifilm Corporation

07/27/17 / #20170211028

Cell culture bag and cell culture method

There is provided a cell culture bag including: plural tubular portions having gas permeability in which a tube axis direction is directed to a first direction and which are arranged side by side in a second direction intersecting with the first direction and are separated from each other using a partition wall; and communication portions having gas permeability which allow communication between two mutually adjacent tubular portions of the plural tubular portions in an intermediate region r between one end and the other end of the tubular portions.. . ... Fujifilm Corporation

07/27/17 / #20170210777

Antibody-binding polypeptide, antibody-binding fusion polypeptide, and adsorption material

Provided are an antibody-binding polypeptide as set forth in any one of seq id nos: 1 to 18 and an adsorption material of an antibody or antibody derivative in which the antibody-binding polypeptide is immobilized on a water-insoluble carrier. These antibody-binding polypeptide and adsorption material have excellent antibody binding properties and selectivity, and also excellent alkali resistance and temporal stability.. ... Fujifilm Corporation

07/27/17 / #20170209509

Agent for reducing the number of intestinal bacteria, food, and pharmaceutical product

The present invention provides an agent for suppressing the number of intestinal bacteria, which contains an extract and/or crushed product of a plant of the genus salacia, wherein the intestinal bacterium is at least one which is selected from the group consisting of the families lachnospiraceae, ruminococcaceae, fusobacteriaceae, and desulfovibrionaceae.. . ... Fujifilm Corporation

07/20/17 / #20170208261

Infrared imaging device, diaphragm control method, and diaphragm control program

An infrared imaging device includes an imaging element including a plurality of infrared detection pixels, a diaphragm, a temperature detection unit that detects the temperature of the diaphragm, a main memory that stores a first signal value corresponding to infrared rays, which are radiated from the diaphragm and are incident on each of the infrared detection pixels of the imaging element, so as to be associated with the f-number and temperature of the diaphragm, and a system control unit that controls the f-number of the diaphragm, based on the first signal value, captured image data obtained by capturing an image of the object using the imaging element in a state in which the f-number of the diaphragm is set to an arbitrary value, the temperature of the diaphragm detected by the temperature detection unit and the arbitrary value.. . ... Fujifilm Corporation

07/20/17 / #20170206580

Merchandise retrieval device and merchandise retrieval method

The merchandise retrieval device includes a first retrieval unit (41) that analyzes a retrieval condition image to acquire first retrieval condition data indicating a design feature of a retrieval condition image, and retrieves a plurality of first retrieval images from a plurality of merchandise images stored in a database (32) based on first retrieval condition data, and a second retrieval unit (42) that retrieves second retrieval images from the first retrieval images based on second retrieval condition data designated as being related to the design feature through a user terminal. The first retrieval unit (41) retrieves the first retrieval images included in a first retrieval range in a feature space representing the design feature. ... Fujifilm Corporation

07/20/17 / #20170206310

Noninvasive discrimination method and discrimination system of chromosomal heteroploidy of fetus

The present invention provides a noninvasive discrimination method of chromosomal heteroploidy of a fetus, the method including a step of analyzing dna of a candidate cell of a nucleated red blood cell isolated from maternal blood, in which the fetuses are fetuses classified into any one case selected from monotocous, monochorionic monoamniotic twin fetuses, monochorionic diamniotic twin fetuses, and dichorionic diamniotic twin fetuses based on results of ultrasonic inspections and the number of candidate cells of nucleated red blood cells to be used for analyzing the dna is optimized based on the classification, and a noninvasive discrimination system of chromosomal heteroploidy of a fetus.. . ... Fujifilm Corporation

07/20/17 / #20170205624

Mirror driving device and driving method thereof

A piezoelectric actuator part which generates a driving force to rotate a mirror part about a rotation axis includes a first actuator part and a second actuator part having a both-end supported beam structure in which base end parts on both sides in an axial direction of the rotation axis are fixed. The first actuator part has a first electrode part and second electrode parts. ... Fujifilm Corporation

07/20/17 / #20170203005

Composition, cell structure, pancreatic islet transplantation kit, pancreatic islet cell transplantation treatment agent and hypoglycemic agent, composition containing pancreatic islet, kit containing pancreatic islet, and pancreatic islet transplantation treatment agent and hypoglycemic agent

An object of the present invention is to provide a composition containing a pancreatic islet, a cell structure containing a pancreatic islet or a pancreatic islet cell, a pancreatic islet transplantation kit, a pancreatic islet transplantation treatment agent, and a hypoglycemic agent which improve at least one of glucose sensitivity or blood sugar level-reducing performance after transplantation, and to provide a composition containing a pancreatic islet, a kit containing a pancreatic islet, a pancreatic islet cell transplantation treatment agent, and a hypoglycemic agent which can improve glucose sensitivity. According to the present invention, a composition including a: a cell structure which contains a biocompatible macromolecular block and at least one kind of cell and in which a plurality of the above-described macromolecular blocks are arranged in gaps between a plurality of the above-described cells; and b: a pancreatic islet, and a composition containing a pancreatic islet; and a spheroid formed of at least one type of stem cell are provided.. ... Fujifilm Corporation

07/20/17 / #20170202774

Liposome composition and method for producing same

Provided are a liposome composition in which an osmotic pressure of an inner water phase is 2-fold to 8-fold relative to the osmotic pressure of an outer water phase, and which encapsulates a water-soluble drug in a dissolved state, and also exhibits excellent preservation stability; and a method for producing the same. According to the present invention, it is possible to provide a liposome composition, including liposomes obtained from lipids dissolved and emulsified in an organic solvent, each of which has an inner water phase and an aqueous solution which constitutes an outer water phase and in which the liposomes are dispersed, in which each of the liposomes encapsulates a water-soluble drug in a dissolved state, and an osmotic pressure of the inner water phase is 2-fold to 8-fold relative to the osmotic pressure of the outer water phase; and a method for producing the same.. ... Fujifilm Corporation

07/20/17 / #20170202437

Endoscope connector, endoscope, and endoscope system

The invention provides an endoscope connector capable of stably performing image communication, an endoscope including the endoscope connector and endoscope system. An endoscope connector is provided in an endoscope having an imaging unit at a distal end of an insertion portion, connected with an endoscope processor device, and provided with an image signal transmitting unit transmitting an image signal with respect to the endoscope processor device via optical communication. ... Fujifilm Corporation

07/13/17 / #20170201729

Projection-type display device and light source control method therefor

. . . . . . . . . . . . A projection-type display device includes: a plurality of light sources that emit light beams with different colors; a projection unit that projects light beams based on image information among light beams emitted from the plurality of light sources onto a projection screen; and a light source control unit that selectively performs first control or second control as defined herein. . ... Fujifilm Corporation

07/13/17 / #20170201696

Infrared imaging device, image processing method, and image processing program

An infrared imaging device includes an imaging element including a plurality of infrared detection pixels which are two-dimensionally arranged, a diaphragm, a temperature detection unit that detects the temperature of the diaphragm, and a digital signal processing unit that subtracts, from at least a portion of each of a plurality of captured image data items obtained by capturing images using the imaging element in a state in which an f-number of the diaphragm is set to a plurality of values, a signal value corresponding to an amount of infrared rays which are radiated from the diaphragm and are based on the f-number when each of the plurality of captured image data items is acquired and the temperature detected by the temperature detection unit and combines the plurality of captured image data items after the subtraction to generate composite image data.. . ... Fujifilm Corporation

07/13/17 / #20170201672

Multi-imaging apparatus, multi-imaging method, program, and recording medium

A multi-imaging apparatus includes: a display unit; an internal imaging device that acquires a first live view image or a first image captured by a main imaging operation thereof; a wireless communication unit that performs wireless communication with an external imaging device that acquires a second live view image or a second image captured by a main imaging operation thereof; and a controller. Here, the controller receives an input of the first live view image from the internal imaging device, receives the second live view image from the external imaging device through the wireless communication unit, and causes the display unit to display the input first live view image and the received second live view image as a multi-live view.. ... Fujifilm Corporation

07/13/17 / #20170201058

Solid-state laser device

A solid-state laser device includes: a first water tank which houses a laser rod and a lamp and into which coolant is introduced; an outer inlet which is provided in a member forming a chamber and through which coolant is received into the chamber; and an outer outlet provided in said member and through which a coolant is discharged to the outside of the chamber. The solid-state laser device further includes: two second water tanks that house electrodes of both ends of the lamp, respectively, and communicate with the first water tank; a coolant inflow passage of which one end communicates with the outer inlet and the other end forms inner inlets opened to only the second water tanks; and a coolant outflow passage of which one end communicates with the outer outlet and the other end forms an inner outlet opened to the first water tank.. ... Fujifilm Corporation

07/13/17 / #20170200568

Aluminum plate

An object is to provide an aluminum plate having favorable coating properties and pre-doping characteristics. An aluminum plate having a plurality of through holes that penetrate in a thickness direction, in which an average opening diameter of the through holes is 1 μm to 100 μm, a density of the through holes is 50 through holes/mm2 to 2,000 through holes/mm2, and an inter-hole distance between adjacent through holes is 300 μm or less.. ... Fujifilm Corporation

07/13/17 / #20170200263

Conductive film, display device having the same, and method of evaluating conductive film

In a conductive film, a method of evaluating a pattern in the conductive film, and a display device, thin metal lines of a wiring portion is formed in a wiring pattern having quadrilateral shapes of which angles are maintained and pitches are made to be irregular. From at least one point of view, in frequencies of the moirés that are equal to or less than a frequency threshold value and are calculated for each color from two peak frequencies and two peak intensities of 2dfft spectra of transmittance image data of rhomboid wiring patterns which are not made to be irregular and luminance image data of pixel array patterns of the respective colors at the time of lighting up for each single color, the thin metal lines has a quadrilateral wiring pattern in which angles of rhomboid shapes of rhomboid wiring patterns, each of which allows the indicator of evaluation of moirés to be equal to or less than the evaluation threshold value, are made to be irregular in a predetermined range. ... Fujifilm Corporation

07/13/17 / #20170199461

Pattern forming method, resist pattern, and process for producing electronic device

The present invention has an object to provide a pattern forming method capable of providing good dof and el, a resist pattern formed by the pattern forming method, and a method for manufacturing an electronic device, including the pattern forming method. The pattern forming method of the present invention includes a step a of coating an active-light-sensitive or radiation-sensitive resin composition onto a substrate to form a resist film, a step b of coating a composition for forming an upper layer film onto the resist film to form an upper layer film on the resist film, a step c of exposing the resist film having the upper layer film formed thereon, and a step d of developing the exposed resist film using a developer to form a pattern, in which the active-light-sensitive or radiation-sensitive resin composition contains a hydrophobic resin.. ... Fujifilm Corporation

07/13/17 / #20170199460

Pattern forming method, resist pattern, and method for manufacturing electronic device

The present invention has an object to provide a pattern forming method capable of providing good dof, a resist pattern formed by the pattern forming method, and a method for manufacturing an electronic device, including the pattern forming method. The pattern forming method of the present invention includes a step a of coating an active-light-sensitive or radiation-sensitive resin composition onto a substrate to form a resist film, a step b of coating a composition for forming an upper layer film onto the resist film to form an upper layer film on the resist film, a step c of exposing the resist film having the upper layer film formed thereon, and a step d of developing the exposed resist film using a developer including an organic solvent to form a pattern, in which the active-light-sensitive or radiation-sensitive resin composition contains a compound having a molecular weight of 870 or less, which generates an acid upon irradiation with active light or radiation.. ... Fujifilm Corporation

07/13/17 / #20170199458

Pattern forming method, etching method and method for producing capacitance-type input device

A pattern forming method includes forming a photosensitive resin composition layer on at least one surface of a substrate using a photosensitive transfer material, exposing the photosensitive resin composition layer; and developing the exposed photosensitive resin composition layer, in which the photosensitive transfer material includes a support, a thermoplastic resin layer, and a photosensitive resin composition layer in this order, and the photosensitive resin composition layer includes a polymer component (a) including a polymer having a constituent unit (a1) that includes a group in which an acid group is protected by an acid-decomposable group and a photoacid generator (b).. . ... Fujifilm Corporation

07/13/17 / #20170199455

Method for forming negative tone pattern, method for manufacturing electronic device, and active-light-sensitive or radiation-sensitive resin composition

The present invention has an object to provide a method for forming a negative tone pattern in which dof of a resist composition used is high and shrinkage of a film in post exposure bake is suppressed; a method for manufacturing an electronic device including the pattern forming method; and an active-light-sensitive or radiation-sensitive resin composition. The method for forming a negative tone pattern of the present invention including: a film formation step of forming a resist film on a substrate, using a resist composition; an exposing step of irradiating the film with active light or radiation; a heating treatment step of performing a heating treatment on the film irradiated with active light or radiation; and a developing step of developing the heating-treated film using a developer including an organic solvent, in which the resist composition includes a resin a having a repeating unit a with a group represented by a specific formula, a resin b having a repeating unit b with a group represented by a specific formula, and a compound that generates an acid upon irradiation with active light or radiation.. ... Fujifilm Corporation

07/13/17 / #20170199449

Projection-type display device and heat dissipation method

A projection-type display device includes: r, g, and b light sources that emit light beams with different colors; a projection unit that projects light beams based on image information among light beams emitted from the light sources onto a projection screen; a heat sink that radiates heat generated from the r light source, which has a maximum change in light emission intensity relative to a change in temperature, among the light sources; and a heat sink that radiates heat generated from the g and b light sources and that has a surface area smaller than that of the heat sink. In a use state, the r light source is disposed on a side apart from the other light sources in a direction opposite to a direction of gravitational force.. ... Fujifilm Corporation

07/13/17 / #20170199378

Head up display apparatus

An optical filter having spectral properties that reflects light of a first wavelength band and transmits light of a second wavelength band that does not include the first wavelength band is provided between a greater distance optical system that displays a virtual image at a greater distance from an image reflection surface and a closer distance optical system that displays a virtual image at a closer distance from the image reflection surface. The optical filter aligns the optical paths of display light of the greater distance optical system and the closer distance optical system and guides the display light to the image reflection surface. ... Fujifilm Corporation

07/13/17 / #20170199375

Mirror driving device and driving method thereof

A piezoelectric actuator part which generates a driving force to rotate a mirror part about a rotation axis includes a first actuator part and a second actuator part having a both-end supported beam structure in which base end parts on both sides in an axial direction of the rotation axis are fixed. Upper electrodes and lower electrodes of the first actuator part and the second actuator part are divided to correspond to a stress distribution of principal stresses in a piezoelectric body during resonance mode vibration, a piezoelectric portion corresponding to positions of a first piezoelectric conversion part and third piezoelectric conversion parts and a piezoelectric portion corresponding to positions of second piezoelectric conversion parts and a fourth piezoelectric conversion part generate stresses in opposite directions.. ... Fujifilm Corporation

07/13/17 / #20170199315

Backlight unit, liquid crystal display device, and wavelength conversion member

Provided is a backlight unit, including: a light source allowing light having a light emission center wavelength of λ nm to exit; and a wavelength conversion member positioned on an optical path of the light exiting from the light source, in which the wavelength conversion member includes a wavelength conversion layer containing a fluorescent material which is excited by exciting light and emits fluorescent light, and a light scattering layer containing particles having a particle size of greater than or equal to 0.1 μm in a matrix, an average refractive index n1 of the wavelength conversion layer satisfies a relationship of n1<n2 with respect to an average refractive index n2 of the matrix of the light scattering layer, and a light absorptivity of the light scattering layer at a wavelength of λ nm is less than or equal to 8.0%.. . ... Fujifilm Corporation

07/13/17 / #20170198149

Wavelength conversion member, backlight unit, liquid crystal display device, quantum dot-containing polymerizable composition, and manufacturing method of wavelength conversion member

The wavelength conversion member includes a wavelength conversion layer containing a quantum dot, in which the wavelength conversion layer is a cured layer formed by curing a polymerizable composition containing the quantum dot and a polymerizable compound, the polymerizable composition contains at least one type of first polymerizable compound, the first polymerizable compound is a monofunctional (meth)acrylate compound in which a value of mw/f obtained by dividing a molecular weight mw by the number f of polymerizable functional groups in one molecule is greater than or equal to 130, the number of (meth)acryloyl groups in one molecule is 1, and a log p value is less than or equal to 3.0, and the polymerizable composition contains greater than or equal to 50 parts by mass of the first polymerizable compound with respect to 100 parts by mass of the total amount of the polymerizable compound contained in the polymerizable composition.. . ... Fujifilm Corporation

07/13/17 / #20170197423

Printing ink

The present invention provides an inkjet ink comprising: an aqueous polyurethane (meth)acrylate dispersion, which is redispersible in water after thermal drying and before curing; a water-dispersible or water-soluble photoinitiator; a surfactant; and a colouring agent. The ink of the present invention is particularly suitable for printing onto a food packaging.. ... Fujifilm Corporation

07/13/17 / #20170197400

Planographic printing plate precursor, method of producing same, and printing method using same

Provided are a planographic printing plate precursor for furnishing a planographic printing plate in which edge stain does not occur, adhesion to interleaving paper is prevented, and the water width with respect to edge stain at the time of printing is wide; a method of producing the same, and a printing method using the same. The planographic printing plate precursor including: a support; an image recording layer formed on the support; and a water-soluble compound having a molecular weight in a range of 60 to 300 and a solubility of 10 g/l or greater in water at 20° c., in which a content of the compound per unit area in a region on the image recording layer side from an end portion of the planographic printing plate precursor to a portion inside the end portion by 5 mm is greater than a content of the compound per unit area in a second region other than the first region by an amount of 50 mg/m2 or greater.. ... Fujifilm Corporation

07/13/17 / #20170197390

Gas barrier film, electronic device, and manufacturing method of gas barrier film

In a gas barrier film having a laminated structure of an organic layer and an inorganic layer, an identification mark is formed on a forming surface of the organic layer. Accordingly, the gas barrier film having the laminated structure of the organic layer and the inorganic layer includes the identification mark which is used for preparing an electronic device, or the like, and can prevent a breakage of the inorganic layer due to the identification mark.. ... Fujifilm Corporation

07/13/17 / #20170197232

Methods for manufacturing ultrasound transducers and other components

The disclosed technology features methods for the manufacture of electrical components such as ultrasound transducers. In particular, the disclosed technology provides methods of creating an ultrasonic transducer by connecting one or more multi-layer printed circuits to an array of ultrasound transducer elements. ... Fujifilm Corporation

07/13/17 / #20170196807

Propofol-containing oil-in-water emulsion composition and method for producing same

Provided are a propofol-containing oil-in-water emulsion composition having high stability even in a case in which the emulsion composition is charged into a plastic container; and a method for producing the same. Provided is a propofol-containing oil-in-water emulsion composition including at least one selected from the group consisting of trishydroxymethylaminomethane, phosphoric acid, and triethanolamine; propofol; an oily component; an emulsifier; and water, in which a dissolved oxygen concentration is 5 mg/l or less and an average emulsion particle size is 180 nm or less.. ... Fujifilm Corporation

07/13/17 / #20170196462

Photoacoustic image generation apparatus

An insertion needle has a light guide member for guiding light emitted from a light source, a light emitting portion for emitting light guided by the light guide member, and a photoacoustic wave generating portion for generating photoacoustic waves caused by light emitted from the light emitting portion. A photoacoustic image generation unit generates a photoacoustic image based on the detection signal of the photoacoustic waves. ... Fujifilm Corporation

07/13/17 / #20170196440

Surgical apparatus for endoscope

Provided is a surgical apparatus for an endoscope that can appropriately and easily perform mounting work of an endoscope onto an outer tube. An outer tube, which passes through a body wall, is inserted into a body cavity, and guides an endoscope and a treatment tool into the body cavity, includes a slider that is an interlocking member that moves the endoscope and the treatment tool forward and backward in an interlocking manner. ... Fujifilm Corporation

07/13/17 / #20170196439

Surgical apparatus for endoscope and exterior tube

Provided are a surgical apparatus for an endoscope and an exterior tube that can supply a pneumoperitoneum gas into a body cavity without causing degradation of operability. An exterior tube is sheathed to an outer tube insertion part of an outer tube that is inserted into a body cavity through a body wall and guides an endoscope and a treatment tool into the body cavity, and an outer peripheral surface of the exterior tube is provided with a locking part that restricts the forward and backward movement of the exterior tube with respect to the body wall and the rotation of the exterior tube around an axis. ... Fujifilm Corporation

07/13/17 / #20170196438

Surgical apparatus for endoscope and outer tube

Provided are a surgical apparatus for an endoscope and an outer tube that ease limitation of the types of available medical instruments to improve convenience and improve operability. An outer tube, which passes through a body wall, is inserted into a body cavity, and guides an endoscope and a treatment tool into the body cavity, includes therein a slider that is an interlocking member that moves the endoscope and the treatment tool forward and backward in an interlocking manner. ... Fujifilm Corporation

07/13/17 / #20170196437

Surgical apparatus for endoscope

Provided is a surgical apparatus for an endoscope with which an operator can change, as desired, the size of an image of a site to be observed that appears in an endoscopic image obtained by an endoscope or the size of the range of the site to be observed. An image processing unit (zooming means) of a processor device changes a zoom magnification factor of an endoscopic image from an endoscope through electronic zooming on the basis of the operation of a foot switch. ... Fujifilm Corporation

07/13/17 / #20170196172

Magnetic sheet for plant cultivation and method of plant cultivation

A magnetic sheet for plant cultivation includes: a base material; and a magnetic layer which is arranged on the base material and includes a resin and at least one selected from the group consisting of a ferromagnetic powder and a ferrimagnetic powder, wherein a product of residual magnetization and layer thickness of the magnetic layer is 20 ma or higher.. . ... Fujifilm Corporation

07/06/17 / #20170195519

Image reading device and method, reading area display device and method, and program

. . . . . . . . In a preferred aspect of the present invention, manuscript image data is analyzed, and a feature amount to be used for specifying a positional relationship between the manuscript image data and read image data of a printed material read by a reading unit that performs reading of the printed material on which an image is printed on the basis of the manuscript image data, is detected. At least one or more areas including the feature amount in the manuscript image data is set as a reading area. ... Fujifilm Corporation

07/06/17 / #20170195503

Image reading device and method, reading area display device and method, and program

In a preferred aspect of the present invention, a color distribution of manuscript image data is analyzed. At least one or more areas satisfying an allowable condition determined for a color distribution in advance in the manuscript image data is set as a reading area on the basis of a result of the analysis of the color distribution of the manuscript image data. ... Fujifilm Corporation

07/06/17 / #20170194547

Thermoelectric conversion material, thermoelectric conversion element, article for thermoelectric power generation and power supply for sensor

A thermoelectric conversion element (1) having, on a substrate (12), a first electrode (13), a thermoelectric conversion layer (14), and a second electrode (15), wherein a nano conductive material and a low band gap material are contained in the thermoelectric conversion layer (14); an article for thermoelectric power generation and a power supply for a sensor using the thermoelectric conversion element (1); and a thermoelectric conversion material containing the nano conductive material and the low band gap material.. . ... Fujifilm Corporation

07/06/17 / #20170193643

Image processing apparatus, image processing method, program, and recording medium

There are provided an image processing apparatus, an image processing method, a program, and a recording medium capable of compatibly achieving a high-accuracy filtering process and reduction in a necessary storage capacity. An image processing apparatus 35 includes a filtering process unit 41 that performs an image filtering process including a plurality of filtering processes. ... Fujifilm Corporation

07/06/17 / #20170193642

Image processing apparatus, filter acquisition apparatus, image processing method, filter acquisition method, program, and recording medium

Further, there are provided a filter acquisition apparatus, a filter acquisition method, a program, and a recording medium, capable of acquiring a filter which is suitably usable in such a filtering process. An image processing apparatus 35 includes a filtering process unit 41 that performs an image filtering process that has a plurality of times of filtering processes. ... Fujifilm Corporation

07/06/17 / #20170192574

Laminate structure, touch panel, display device with touch panel, and method of manufacturing same

A laminate structure has a three-dimensional shape and is provided with an optically transparent region. The laminate structure has a transparent conductive member provided with at least one conductive layer constituted of fine metal wires on a flexible transparent substrate, a wiring formed on the transparent substrate and electrically connected to the conductive layer, and a cover member protecting the transparent conductive member. ... Fujifilm Corporation

07/06/17 / #20170192355

Method for forming negative tone pattern, method for manufacturing electronic device, and active-light-sensitive or radiation-sensitive resin composition

The present invention has an object to provide a method for forming a negative tone pattern in which shrinkage of a film in post exposure bake is suppressed; a method for manufacturing an electronic device including the pattern forming method; and an active-light-sensitive or radiation-sensitive resin composition. The method for forming a negative tone pattern of the present invention includes: a film formation step of forming an active-light-sensitive or radiation-sensitive resin composition film on a substrate, using a resist composition; an exposing step of irradiating the film with active light or radiation; a heating treatment step of performing a heating treatment on the film irradiated with active light or radiation; and a developing step of developing the heating-treated film using a developer including an organic solvent, in which the resist composition includes a resin a having a repeating unit a with a group represented by a specific formula, a resin b having a repeating unit b with a group represented by a specific formula, and a compound that generates an acid upon irradiation with active light or radiation.. ... Fujifilm Corporation

07/06/17 / #20170192231

Member for displaying projected image and projected image display system

The present invention provides a member for displaying a projected image and a projected image display system in which a clear image can be displayed with high reflectivity and high transmittance without a double image, the member for displaying a projected image including a reflection layer, and a λ/2 phase difference layer, in which the reflection layer includes a cholesteric liquid crystal layer having selective reflection in a visible light range, and the projected image display system including the member for displaying a projected image, in which the λ/2 phase difference layer is disposed on an incidence ray side with respect to the reflection layer, and the incidence ray is p-polarized light which vibrates in a direction parallel to an incidence surface.. . ... Fujifilm Corporation

07/06/17 / #20170192196

Zoom lens barrel, interchangeable lens, and television camera device

A zoom lens barrel houses plural lens frames holding plural movable lens units and supporting the plural movable lens units so that the movable lens units are movable forward and rearward along an optical axis. The zoom lens barrel includes a first lens frame and a second lens frame of the plural lens frames adjacent to each other, and plural first linear motors and plural second linear motors that move the first lens frame and the second lens frame forward and rearward independently for focusing associated with zooming. ... Fujifilm Corporation

07/06/17 / #20170192146

Wavelength conversion member and backlight unit including same, and liquid crystal display device

A wavelength conversion member including a wavelength conversion layer containing quantum dots which are excited by exciting light and emit fluorescent light rays, in which the wavelength conversion layer includes base material films on at least one surface, and in the base material films, an absorbance of light at a wavelength of 450 nm measured by using an integrating sphere is less than 0.9%, and a total light ray transmittance is less than 92%.. . ... Fujifilm Corporation

07/06/17 / #20170192145

Circularly polarizing plate and display device

The present invention provides a circularly polarizing plate that improves the visibility of black color in an oblique direction when being applied to a display device and having a small thickness, the display device including a circularly polarizing plate. The circularly polarizing plate is a circularly polarizing plate including, in this order, a polarizer, a λ/2 plate, and a λ/4 plate, in which the λ/2 plate is a laminate of a first a-plate and a first c-plate, the λ/4 plate is a laminate of a second a-plate and a second c-plate, one of the first c-plate and the second c-plate is a cellulose acylate film having a predetermined rth, and the other of the first c-plate and the second c-plate is an optically anisotropic layer including a liquid crystal compound having a predetermined rth or a cellulose acylate film having a predetermined rth.. ... Fujifilm Corporation

07/06/17 / #20170191021

Cell culture device and method

A cell culture device and a cell culture method that enable living tissues for transplantation having constant qualities to be stably supplied as products are provided. A plurality of cell culture portions that respectively culture a plurality of cell culture units; a maturity evaluation portion that respectively evaluates maturity of the respective cell culture units in the respective cell culture portions and a movement target cell determining portion that determines a cell culture unit that does not satisfy a predetermined condition as a target to be moved to another cell culture portion in a case where the cell culture unit of which maturity does not satisfy the predetermined condition among a plurality of cell culture units cultured in any one cell culture portion of the plurality of cell culture portions exists are provided.. ... Fujifilm Corporation

07/06/17 / #20170190928

Coloring composition, ink jet recording ink, and ink jet recording method

Provided are a coloring composition, an ink jet recording ink, and an ink jet recording method, the coloring composition including a betaine compound and at least one xanthene compound of a compound represented by formula (1), a compound represented by formula (2), a compound having a repeating unit represented by formula (3), or a compound represented by formula (4).. . ... Fujifilm Corporation

07/06/17 / #20170190923

Near-infrared absorption composition, curable composition, cured film, near-infrared cut filter, solid-state imaging device, infrared sensor, camera module, processed coloring agent, and method of manufacturing processed coloring agent

The near-infrared absorption composition includes a processed coloring agent obtained by coating a near-infrared absorption coloring agent with a resin having one or more selected from a coloring agent structure, a heterocyclic structure, and an acyclic hetero atom-containing group. The near-infrared absorption coloring agent is preferably one or more selected from a phthalocyanine coloring agent, a perylene coloring agent, a pyrrolopyrrole coloring agent, a cyanine coloring agent, a dithiol metal complex coloring agent, a naphthoquinone coloring agent, a diimmonium coloring agent, an azo coloring agent, and a squarylium coloring agent and more preferably a pyrrolopyrrole coloring agent.. ... Fujifilm Corporation

07/06/17 / #20170190200

Image forming medium, method for producing image forming medium, and image forming method

An image forming medium capable of forming an image without using a printer including a plurality of first metal electrodes extending in one direction and being parallel to one another, a first oxide layer in which the first metal electrodes are embedded and which is made of an oxide of a metal constituting the first metal electrodes, a plurality of second metal electrodes extending in one direction and crossing the first electrodes in a surface direction of the first oxide layer, a second oxide layer in which the second metal electrodes are embedded and which is made of an oxide of a metal constituting the second metal electrodes, and a thermal color developing layer provided on the first metal electrodes or the second metal electrodes, in which the second metal electrodes are separated from the first metal electrodes by the second oxide layer.. . ... Fujifilm Corporation

07/06/17 / #20170190188

Image recording method and image recorded article

Provided are an image recording method including: subjecting a recording substrate to a surface treatment by irradiating an image recording surface of the recording substrate with light from excimer emission using a xenon gas, the recording substrate being an aggregate of non-absorbent or low-absorbent fiber materials; and applying an ink composition by an ink jet method onto the image recording surface of the recording substrate after the surface treatment; and an image recorded article.. . ... Fujifilm Corporation

07/06/17 / #20170190179

Fluid ejection devices

A fluid ejector includes a nozzle layer, a body, an actuator and a membrane. The body includes a pumping chamber, a return channel, and a first passage fluidically connecting the pumping chamber to an entrance of the nozzle. ... Fujifilm Corporation

07/06/17 / #20170190167

Planographic printing plate precursor, method of producing same, and printing method using same

Provided is a planographic printing plate precursor including: a support; and an image recording layer formed on the support, in which the content of fine particles per unit area in a region on a plate surface on the image recording layer side from an end portion of the planographic printing plate precursor to a portion inside the end portion by 5 mm is greater than the content of the fine particles per unit area in a region other than the region by an amount of 10 mg/m2 or greater, edge stains are not generated therein, and transferring of the image recording layer is prevented even in a case where planographic printing plate precursors are stored in a stacked state. Further, provided are a method of producing the same and a printing method using the same.. ... Fujifilm Corporation

07/06/17 / #20170188839

Photoacoustic image generation apparatus

An insertion needle includes an outer needle and an inner needle, and the inner needle includes a light emitting portion and a photoacoustic wave generating portion. An insertion and removal detection unit detects that the inner needle of the insertion needle has been removed from the outer needle. ... Fujifilm Corporation

07/06/17 / #20170188838

Photoacoustic image generation method and apparatus

In a photoacoustic image generation apparatus for obtaining a photoacoustic signal by emitting light toward a subject from a light source and detecting photoacoustic waves emitted from the subject having received the light and imaging the subject based on the photoacoustic signal, there are provided: means for removing a signal showing a component appearing discontinuously in the subject from photoacoustic signals relevant to a plurality of cross sections of the subject that have been generated by changing an angle between an emission direction of the light and a surface of the subject; and means for constructing a three-dimensional image of the subject from photoacoustic signals showing the plurality of cross sections after the removal processing.. . ... Fujifilm Corporation

06/29/17 / #20170187951

Imaging device and focus control method

. . . . A phase difference af processing unit of a digital camera including an imaging element that captures an image of an object through a lens device including an apd filter and includes a pair of phase difference detection pixels calculates a parameter related to a ratio of a phase difference between detection signals detected by each of the phase difference detection pixels to an amount of defocus based on the incident angle range of light on the pair of phase difference detection pixels through the lens device, the transmittance of a region of the apd filter through which light in the incident angle range passes, and a light reception sensitivity distribution indicating the light reception sensitivity of each of the phase difference detection pixels for each incident angle of light and calculates the amount of defocus using the parameter and the phase difference.. . ... Fujifilm Corporation

06/29/17 / #20170187950

Imaging device and focus control method

In a state in which an apd filter is present on an optical axis of an imaging optical system, a digital camera sets the maximum movable amount of a focus lens to one side of an optical axis direction to a value that is less than that in a state in which the apd filter is not present on the optical axis of the imaging optical system and moves the focus lens in the range of the set maximum movable amount.. . ... Fujifilm Corporation

06/29/17 / #20170187823

System and method for providing caching and pre-fetch of assets/media

A system and method for routing and delivering pre-fetched assets/media, such as a digital image, is provided. The present invention is directed to a system that allows for two digital images to be pre-fetched or otherwise transferred concurrently from two separate source devices to virtually expand the bandwidth and increase the efficiency of the transfer. ... Fujifilm Corporation

06/29/17 / #20170186936

Piezoelectric element production method thereof, actuator, and liquid discharge apparatus

A piezoelectric element includes: a titanium-containing adhesion layer, a lower electrode, a pzt-based piezoelectric film, and an upper electrode, which are sequentially provided on a silicon substrate, in which the lower electrode includes a columnar structure film consisting of a large number of columnar crystals which are grown from a surface of the titanium-containing adhesion layer and have a platinum group element as a primary component, and an adhesion layer component diffused from the titanium containing adhesion layer and oxygen diffused from the piezoelectric film side, which are present in the columnar structure film, and a main column diameter of the columnar crystal of the columnar structure film is 50 nm or more and 200 nm or less.. . ... Fujifilm Corporation

06/29/17 / #20170186460

Magnetic tape and magnetic tape device

The magnetic tape has a magnetic layer containing ferromagnetic powder and binder on a nonmagnetic support, wherein the coercive force measured in the longitudinal direction of the magnetic tape is less than or equal to 167 ka/m, a timing-based servo pattern is present on the magnetic layer, and the edge shape specified by observing the timing-based servo pattern with a magnetic force microscope is a shape in which the difference between the value of the 99.9% cumulative distribution function of the width of misalignment from the ideal shape in the longitudinal direction of the magnetic tape and the value l0.1 of the 0.1% cumulative distribution function, l99.9-l0.1, is less than or equal to 180 nm.. . ... Fujifilm Corporation

06/29/17 / #20170186456

Magnetic tape and method of manufacturing the same

The magnetic tape has a nonmagnetic layer containing nonmagnetic powder and binder on a nonmagnetic support and a magnetic layer containing ferromagnetic powder and binder on the nonmagnetic layer, wherein a fatty acid ester is contained in at least the magnetic layer, the ferromagnetic powder is ferromagnetic hexagonal ferrite powder, the ferromagnetic hexagonal ferrite powder has a crystallite volume as determined by x-ray diffraction analysis ranges from 1,000 nm3 to 2,400 nm3, and a ratio of the crystallite size dx(107) obtained from a diffraction peak of a (107) plane to a particle size in a direction of an easy axis of magnetization dtem as determined by observation with a transmission electron microscope, dx(107)/dtem, is greater than or equal to 1.1, and Δsfd in a longitudinal direction of the magnetic tape as calculated with equation 1: Δsfd=sfd25° c.−sfd−190° c., ranges from 0.50 to 1.60.. . ... Fujifilm Corporation

06/29/17 / #20170185744

Medical support apparatus and system, and non-transitory computer readable medium

A medical support apparatus provides plural test data and plural medication data, the test data being data of stored combinations of a test item, a test value and date/time information of a diagnostic test performed to a patient body, the medication data being data of stored combinations of a type (name), a dose and an administration period of a medicine administered to the patient body. An acquisition unit acquires a relationship dataset constituted by the medication data of at least one medicine and the test data of at least one test item susceptible to influence of administering the medicine to the patient body. ... Fujifilm Corporation

06/29/17 / #20170185187

Conductive film for touch panel and touch panel

Provided is a conductive film for a touch panel including: a flexible transparent resin substrate having a thickness equal to or smaller than 40 μm; a plurality of detection electrodes which are formed on at least one surface of the resin substrate; a plurality of peripheral wirings which are formed on at least one surface of the resin substrate and respectively connected to the plurality of detection electrodes; and a plurality of external connection terminals which are formed on at least one surface of the resin substrate and respectively connected to the plurality of peripheral wirings, in which the plurality of external connection terminals are arranged such that adjacent external connection terminals are separated from each other by a distance between terminals of 100 μm to 200 μm with a pitch equal to or smaller than 500 μm, and respectively have a terminal width equal to or greater than the distance between terminals.. . ... Fujifilm Corporation

06/29/17 / #20170184974

Pattern forming method, resist pattern, and method for manufacturing electronic device

Provided are a pattern forming method capable of providing good dof and ler, a resist pattern formed by the pattern forming method, and a method for manufacturing an electronic device, including the pattern forming method. The pattern forming method includes a step a of coating an active-light-sensitive or radiation-sensitive resin composition onto a substrate to form a resist film, a step b of coating a composition for forming an upper layer film onto the resist film, followed by carrying out heating to 100° c. ... Fujifilm Corporation

06/29/17 / #20170184973

Organic treatment liquid for patterning resist film, method of producing organic treatment liquid for patterning resist film, storage container of organic treatment liquid for patterning resist film, pattern forming method using the same, and method of producing electronic device

An organic treatment liquid for patterning a resist film, in which a metal element concentration of each of na, k, ca, fe, cu, mg, mn, li, al, cr, ni, and zn is 3 ppm or less and which can reduce generation of particles, in a negative tone pattern forming method for forming a miniaturized (for example, 30 nm node or less) pattern by particularly using an organic developer, a method of producing the organic treatment liquid for patterning a resist film, a storage container of the organic treatment liquid for patterning a resist film, a pattern forming method using the same, and a method of producing an electronic device can be provided.. . ... Fujifilm Corporation

06/29/17 / #20170184970

Pattern forming method, composition for forming upper layer film, resist pattern, and method for manufacturing electronic device

Provided are a pattern forming method capable of providing good dof, el, and watermark defect performance, a resist pattern formed by the pattern forming method, a composition for forming an upper layer film, used in the pattern forming method, and a method for manufacturing an electronic device, including the pattern forming method. The pattern forming method includes a step a of coating an active-light-sensitive or radiation-sensitive resin composition onto a substrate to forming a resist film, a step b of coating a composition for forming an upper layer film onto the resist film to form an upper layer film on the resist film, a step c of exposing the resist film having the upper layer film formed thereon, and a step d of developing the exposed resist film using a developer including an organic solvent to form a pattern, in which a receding contact angle of water on a surface of the upper layer film is 80° or more.. ... Fujifilm Corporation

06/29/17 / #20170183504

Hardcoat film, method for manufacturing hardcoat film, polarizing plate, and liquid crystal display device

Provided is a hardcoat film having a film thickness of 25 μm or less in which a polymerized substance of a compound having an energy ray-curable group and a resin are mixed across an entire region in a film thickness direction, in which a percentage of a mass concentration of the resin which is represented by the expression (1) as defined herein has a distribution in which the percentage is maximized on at least one of two opposed surfaces, in the film thickness direction, of the hardcoat film or at a central part, in the film thickness direction, of the hardcoat film.. . ... Fujifilm Corporation

06/29/17 / #20170183503

Method for manufacturing hardcoat film and hardcoat film

The invention is directed to a method for manufacturing a hardcoat film including a hardcoat layer having a surface of which a water contact angle is 65° or less by applying, drying, and curing a composition for forming the hardcoat layer on a base material film, in which the composition for forming the hardcoat layer contains the components (a) to (d) as defined herein, and, in a case in which a total solid content of the composition for forming the hardcoat layer is set to 100% by mass, a content of the component (b) is 40% to 80% by mass, a content of the component (c) is 10% to 40% by mass, and a content of the component (d) is 10% to 40% by mass.. . ... Fujifilm Corporation

06/29/17 / #20170182822

Print management device, print management method, and print management program

The print management device includes a print management information acquisition unit that acquires print management information including first information indicating quality of a printed material printed in a print job during execution and second information indicating an evaluation index of the printed material, different from the first information, in the print job during execution, a print management request acquisition unit that acquires request information indicating a request relating to print management of the printed material in the print job, a request evaluation unit that evaluates the degree of satisfaction of the printed material printed in the print job for the request relating to the print management indicated by the request information, based on the print management information, using one or more evaluation references, and a printing condition change determination unit that determines whether change in printing conditions in the print job during execution is necessary, based on an evaluation result.. . ... Fujifilm Corporation

06/29/17 / #20170182762

Method of presenting measurement position, method of manufacturing measurement position presentation guide, method of measuring print material, method of determining measurement position of print material, and device for determining measurement position of print material

A measurement position presentation guide indicating a measurement position of the print material is generated on the basis of the print image data. To achieve the second object, print image data is analyzed to extract a plurality of measurement candidate regions that are candidates of a measurement position. ... Fujifilm Corporation

06/29/17 / #20170182621

Lens manufacturing method, lens, and lens holding device

A lens manufacturing method including a holding step of holding a lens in a lens holding fixture, and a machining step of machining a surface to be machined in the held lens. A reverse surface of the surface to be machined is machined into a non-planar shape with a first surface shape error. ... Fujifilm Corporation

06/29/17 / #20170181640

Photoacoustic image generation method and apparatus

In a photoacoustic image generation apparatus for generating a photoacoustic image of a subject including an interventional instrument for each scanning plane, there are provided: means for generating a reflected acoustic wave image of the subject for each scanning plane; means for detecting a change in a photoacoustic image on an observation scanning plane, which is generated as an image, from a plurality of photoacoustic images regarding the observation scanning plane; means for detecting a change in a reflected acoustic wave image on the observation scanning plane from a plurality of reflected acoustic wave images regarding the observation scanning plane; determination means for determining whether or not a distal end of the interventional instrument is present on the observation scanning plane based on the change in the photoacoustic image and the change in the reflected acoustic wave image; and notification means for sending notification of a result of the determination.. . ... Fujifilm Corporation

06/29/17 / #20170181639

Photoacoustic image generation apparatus and method

After light has been output to a subject to be examined, a photoacoustic wave induced in the subject by the output light is detected. It is assumed that at least one virtual detector element is present outside of a real detector, and dummy data corresponding to the at least one virtual detector element are added to photoacoustic data in which pieces of data of the photoacoustic wave detected by the detector are arranged in accordance with the positions of detector elements. ... Fujifilm Corporation

06/22/17 / #20170180650

Imaging control device, imaging control method, imaging system, and program

. . . . . . . . A live view control device according to an aspect of the present invention includes a radio wave intensity detection unit that detects radio wave intensity with respect to each of a plurality of imaging devices, a priority setting unit that sets a priority of a plurality of live view images on the basis of the detected radio wave intensity, a transfer condition setting unit that sets transfer conditions including at least one of a frame rate of transfer and an image size of the transfer of each of the plurality of live view images on the basis of the priorities of the plurality of live view images, and a communication control unit that transmits the set transfer conditions to the plurality of imaging devices via a wireless communication unit.. . ... Fujifilm Corporation

06/22/17 / #20170180635

Imaging control apparatus, imaging control method, camera system, and program

An imaging control device according to an aspect of the present invention includes a rotation instruction input unit that receives an input of an instruction of rotation of a pan and tilt mechanism of a camera, a rotation instruction output unit that outputs the rotation instruction to the camera, an image input unit that receives a live view image according to the rotation instruction from the camera, and a display control unit that causes the display unit to perform a display for superimposing the live view image input from the camera on a limit display image of a two-dimensionally displayed spherical surface indicating an imagable region and a non-imagable region respectively corresponding to within a rotation limit and out of the rotation limit of the imaging unit of the camera, and rotating the limit display image along the two-dimensionally displayed spherical surface according to the input of the rotation instruction.. . ... Fujifilm Corporation

06/22/17 / #20170180626

Live view control device, live view control method, live view system, and program

A live view control device according to an aspect of the present invention includes a display control unit that displays each of a plurality of live view images received from a plurality of imaging devices in each of a plurality of areas of a display screen, a priority setting unit that sets a priority of the plurality of live view images, a transfer condition setting unit that sets transfer conditions including at least one of a frame rate of transfer and an image size of the transfer of the plurality of live view images on the basis of the priority of the plurality of live view images, and a communication control unit that transmits a transfer instruction for a live view image according to the set transfer conditions to the plurality of imaging devices via the wireless communication unit.. . ... Fujifilm Corporation

06/22/17 / #20170179415

Organic field-effect transistor, method for manufacturing organic semiconductor crystal, and organic semiconductor element

An object of the present invention is to provide an organic field-effect transistor from which a liquid crystal compound used for aligning an organic semiconductor does not need to be removed and which has excellent mobility, an organic semiconductor element, and a method for manufacturing an organic semiconductor crystal used in the organic field-effect transistor and the organic semiconductor element. An organic field-effect transistor of the present invention includes a first layer which consists of an organic semiconductor compound and a second layer which is adjacent to the first layer and consists of a liquid crystal compound, in which an organic semiconductor crystal in the first layer has a size of equal to or greater than 100 μm×100 μm.. ... Fujifilm Corporation

06/22/17 / #20170179413

Transistor and manufacturing method of transistor

A transistor and a manufacturing method of a transistor which prevents a decrease in mobility, prevents a decrease in a withstand voltage of the insulating layer, and prevents a short circuit between a gate electrode and a semiconductor layer due to curvature. A substrate having insulating properties, a source electrode and a drain electrode disposed in a surface direction of a main surface of the substrate by being separated from each other, a gate electrode disposed between the source electrode and the drain electrode in the surface direction of the substrate, a semiconductor layer disposed in contact with the source electrode and the drain electrode, and an insulating film disposed between the gate electrode and the semiconductor layer in a direction perpendicular to the main surface of the substrate are included, and a gap region is formed between the semiconductor layer and the insulating film.. ... Fujifilm Corporation

06/22/17 / #20170179388

Method for producing organic semiconductor film and organic transistor

A method for producing an organic semiconductor film includes performing, in random order, applying an ink including an organic semiconductor, a first solvent having high affinity for the organic semiconductor, and a second solvent having lower affinity for the organic semiconductor than the first solvent and having a higher boiling point than the first solvent, to a lyophilic region of a substrate having at least one of a lyophilic region or a liquid repellent region disposed in the vicinity of the lyophilic region on a surface, and applying a solvent composed of the same type of solvent as the first solvent and used for controlling a volatilization rate of the first solvent in the ink applied to the lyophilic or the liquid repellant region; and then causing the first and second solvent in the ink applied to the lyophilic region to volatilize to produce an organic semiconductor film.. . ... Fujifilm Corporation

06/22/17 / #20170179387

Organic semiconductor composition, organic thin film transistor, electronic paper, and display device

The present invention provides an organic semiconductor composition which makes it possible to prepare an organic thin film transistor having excellent insulation reliability while inhibiting the deterioration of mobility, and to provide an organic thin film transistor prepared using the composition. Furthermore, the present invention provides electronic paper and a display device which contain the organic thin film transistor. ... Fujifilm Corporation

06/22/17 / #20170179363

Thermoelectric conversion element and thermoelectric conversion module

The present invention has a first substrate having a high thermal conduction portion which has a thermal conductivity higher than that of other regions in a plane direction, a thermoelectric conversion layer which is formed on the first substrate, consists of an organic material, and has a thermoelectric conversion material having a positive seebeck coefficient, a second substrate which is formed on the thermoelectric conversion layer and has a high thermal conduction portion having a thermal conductivity higher than that of other regions in the plane direction and in which the high thermal conduction portion does not completely overlap the high thermal conduction portion of the first substrate in the plane direction, and a pair of electrodes which are connected to the thermoelectric conversion layer and consist of a metal material having a negative seebeck coefficient. As a result, there are provided a thermoelectric conversion element and a thermoelectric conversion module which can generate heat with excellent efficiency by using a thermoelectric conversion material consisting of an organic material.. ... Fujifilm Corporation

06/22/17 / #20170179361

Thermoelectric conversion element, thermoelectric conversion module, method for manufacturing thermoelectric conversion element, and method for manufacturing thermoelectric conversion module

A thermoelectric conversion layer contains carbon nanotubes and a surfactant, and in an upper portion and a lower portion and/or a side face end surface and a center, a mass ratio obtained by dividing the carbon nanotubes by the surfactant is higher in the upper portion and/or the end surface than in the other portions. A layer which contains carbon nanotubes and a surfactant and will become a thermoelectric conversion element is formed, the layer is washed with a washing agent which dissolves the surfactant but does not dissolve the carbon nanotubes. ... Fujifilm Corporation

06/22/17 / #20170178677

Magnetic tape, magnetic tape cartridge, and magnetic recording and reproducing device

The magnetic tape includes a nonmagnetic layer containing nonmagnetic powder and binder on a nonmagnetic support, and a magnetic layer containing ferromagnetic powder, abrasive, and binder on the nonmagnetic layer, wherein a thickness of the nonmagnetic layer is less than or equal to 0.50 μm, a coefficient of friction as measured on a base portion of a surface of the magnetic layer is less than or equal to 0.35, and Δsfd in a longitudinal direction of the magnetic tape as calculated with equation 1, Δsfd=sfd25° c.−sfd−190° c., is greater than or equal to 0.50, wherein, in equation 1, sfd25° c. Denotes a sfd as measured in the longitudinal direction of the magnetic tape in an environment with a temperature of 25° c., and sfd−190° c. ... Fujifilm Corporation

06/22/17 / #20170178676

Magnetic tape, magnetic tape cartridge, magnetic recording and reproducing device, and method of manufacturing magnetic tape

The magnetic tape has a nonmagnetic layer containing nonmagnetic powder and binder on a nonmagnetic support, and a magnetic layer containing ferromagnetic powder and binder on the nonmagnetic layer; wherein the combined thickness of the nonmagnetic layer and the magnetic layer is less than or equal to 0.60 μm, the coefficient of friction as measured on the base portion of the surface of the magnetic layer is less than or equal to 0.35, at least the magnetic layer contains one or more components selected from the group consisting of a fatty acid and a fatty acid amide, and a c—h derived carbon, c, concentration calculated from a c—h peak area ratio in a c1s spectrum obtained by x-ray photoelectron spectroscopy conducted at a photoelectron take-off angle of 10 degrees on the surface of the magnetic layer is greater than or equal to 45 atom %.. . ... Fujifilm Corporation

06/22/17 / #20170178675

Magnetic tape and method of manufacturing the same

The magnetic tape has a magnetic layer containing ferromagnetic powder and binder on the surface on one side of a nonmagnetic support and has a backcoat layer containing nonmagnetic powder and binder on the surface on the other side thereof, wherein the centerline average surface roughness ra as measured on the surface on the magnetic layer side of the magnetic tape is less than or equal to 1.8 nm, the logarithmic decrement as determined by a pendulum viscoelasticity test on the surface on the magnetic layer side of the magnetic tape is less than or equal to 0.050, and the logarithmic decrement as determined by a pendulum viscoelasticity test on the surface on the backcoat layer side is less than or equal to 0.060.. . ... Fujifilm Corporation

06/22/17 / #20170177962

Image recording device, image defect detection device, and image defect detection method

An image defect detection device that divides an original print image and a print image printed on the basis of the original print image into corresponding regions, acquires an image feature amount of each divided region, extracts a strength of a difference of each divided region between the original print image and the print image, calculates an image defect detection time indicating a time required to detect a defect of each divided region of the print image from the image feature amount and the strength of the difference of each divided region, calculates an expected image defect value indicating a possibility of presence of a defect in each divided region of the print image from the image feature amount and the strength of the difference of each divided region, determines an order of detection of the image defect of the divided region of the print image.. . ... Fujifilm Corporation

06/22/17 / #20170177120

Conductive film for touch panel

Provided is a conductive film for a touch panel including: an insulating substrate including a pair of surfaces facing each other; a detection electrode pattern portion which is formed of thin metal wires formed on at least one surface of the pair of surfaces of the insulating substrate; a wiring portion which is disposed on the same surface as the surface of the insulating substrate where the detection electrode pattern portion is formed, and includes a plurality of lead-out wirings formed of metal which are connected to the detection electrode pattern portion; and a shielding electrode farmed of metal which is disposed on a surface on a side opposite to the surface of the insulating substrate where the wiring portion is disposed and at a position corresponding to the wiring portion, in which the shielding electrode includes a mesh-like pattern portion which is formed of metal wires respectively intersecting with the lead-out wirings of the wiring portion and has an opening ratio equal to or greater than 80%, and has sheet resistance equal to or smaller than 20 Ω/sq.. . ... Fujifilm Corporation

06/22/17 / #20170177118

Manufacturing method of touch sensor film, touch sensor film, and touch panel

A touch sensor film preventing moire occurring in accordance with deformation of a support is manufactured by performing roll transportation of an elongated transparent support 1 having a thickness smaller than 80 μm using a plurality of pass rollers 4, 5, and 6; performing annealing treatment with respect to the support 1 at a temperature which is equal to or lower than a temperature obtained by adding 35° c. To a dynamic glass transition temperature of the support 1; and forming a mesh pattern formed of thin metal wires 8a on a surface of the support 1 subjected to the annealing treatment.. ... Fujifilm Corporation

06/22/17 / #20170176862

Pattern forming method, composition for forming protective film, method for manufacturing electronic device, and electronic device

A pattern forming method includes coating an actinic ray-sensitive or radiation-sensitive resin composition onto a substrate to form an actinic ray-sensitive or radiation-sensitive film, coating a composition for forming a protective film onto the actinic ray-sensitive or radiation-sensitive film to form a protective film, exposing the actinic ray-sensitive or radiation-sensitive film covered with the protective film, and developing the exposed actinic ray-sensitive or radiation-sensitive film using a developer containing an organic solvent, in which the protective film contains a compound (a) including at least one group or bond selected from the group consisting of an ether bond, a thioether bond, a hydroxyl group, a thiol group, a carbonyl bond, and an ester bond, and a resin (x).. . ... Fujifilm Corporation

06/22/17 / #20170176858

Pattern forming method, method for manufacturing electronic device, resist composition and resist film

Provided are a pattern forming method in which the resolving power of an isolated space pattern formed is excellent, and a method for manufacturing an electronic device, a resist composition, and a resist film, each using the pattern forming method. The pattern forming method is a pattern forming method including at least a step of forming a resist film using a resist composition, a step of exposing the resist film, and a step of developing the exposed resist film using a developer including an organic solvent to form a pattern, in which the resist composition contains a resin (ab) including a metal ion.. ... Fujifilm Corporation

06/22/17 / #20170176580

Electromagnetic cloaking structure and method for manufacturing the same

In an electromagnetic cloaking structure, a refractive index distribution has a high refractive index region which is provided around a shielding space and has a maximum value in a plane surrounding the shielding space and in which a refractive index decreases gradually from the centroid of the shielding space along a radial line passing through the plane so as to be close to an average refractive index and a low refractive index region which has a minimum value at two points having the shielding space and the high refractive index region interposed therebetween on a virtual optical axis passing through the shielding space and in which the refractive index increases gradually from the two points in a direction opposite to the high refractive index region on the virtual optical axes, on which the two points are placed, so as to be close to the average refractive index.. . ... Fujifilm Corporation

06/22/17 / #20170176258

Infrared image acquisition device and infrared image acquisition method

Disclosed is an infrared image acquisition device capable of preventing a glare on a subject and acquiring an infrared image suitable for calculating the temperature of the subject. An infrared image acquisition device includes an infrared imaging unit, a corresponding area detection unit, a glare area detection unit, and an image correction unit. ... Fujifilm Corporation

06/22/17 / #20170174916

Gel particles, photosensitive composition, ink composition, method of producing water dispersion of gel particles, and image forming method

Provided are gel particles each having a three-dimensional crosslinked structure including at least one bond selected from a urethane bond and a urea bond, the gel particles each including: a polymerizable group; and a functional group that generates radicals by irradiation with active energy rays, a photosensitive composition containing the gel particles, an ink composition, a method of producing water dispersion of gel particles, and an image forming method.. . ... Fujifilm Corporation

06/22/17 / #20170174913

Gel particles, ink composition and production method thereof, photosensitive composition, and image forming method

There are provided gel particles which have a polymerizable group, and a three-dimensional crosslinked structure including at least one bond selected from a urethane bond and a urea bond, and enclose a photopolymerization initiator, an ink composition including the gel particles and a production method thereof, a photosensitive composition, and an image forming method.. . ... Fujifilm Corporation

06/22/17 / #20170174837

Process for the production of polyimide and polyamic ester polymers

Provided are a composition of which dispersibility of particles including a pyrrolopyrrole coloring agent is satisfactory, a method of manufacturing a composition, a curable composition, a cured film using a curable composition, a near-infrared cut filter, a solid-state imaging device, an infrared sensor, and a camera module. The composition includes particles including a coloring agent represented by formula (1), in which an average secondary particle diameter of the particles is 500 nm or less. This disclosure relates to a process of purifying a polymer. The process includes (a) providing an organic solution containing a polyimide or polyamic ester in at least one polar, aprotic polymerization solvent; (b) adding at least one purification solvent to the organic solution to form a diluted organic solution, the at least one purification solvent is less polar than the at least one polymerization solvent and has a lower water solubility than the at least one polymerization solvent at 25° c.; (c) washing the diluted organic solution with water or an aqueous solution to obtain a washed organic solution; and (d) removing at least a portion of the at least one purification solvent in the washed organic solution to obtain a solution containing a purified polyimide or polyamic ester. ... Fujifilm Corporation

06/22/17 / #20170174801

Non-chemical amplification type resist composition, non-chemical amplification type resist film, pattern forming method, and method for manufacturing electronic device

Provided are a non-chemical amplification type resist composition in which the resolving power in an isolated line pattern or an isolated space pattern is excellent, and a non-chemical amplification type resist film, a pattern forming method, and a method for manufacturing an electronic device. The non-chemical amplification type resist composition contains a resin (ab) having a metal salt structure.. ... Fujifilm Corporation

06/22/17 / #20170173938

Photosensitive resin composition, planographic printing plate precursor, method for producing planographic printing plate, and polymer compound

Provided are a photosensitive resin composition which enables production of a lithographic printing plate precursor having a non-image portion which has good solubility in an alkali aqueous solution and which enables production of a lithographic printing plate having excellent chemical resistance and excellent printing durability, a lithographic printing plate precursor obtained by using the photosensitive resin composition, a method for producing a lithographic printing plate, and a new polymer compound. The photosensitive resin composition of the present invention contains: a polymer compound which has an amine bond or a quaternary ammonium salt bond, and at least one bond selected from the group consisting of a urea bond, a urethane bond, and a carbonate bond in the main chain and has a sulfonamide group or a phenolic hydroxyl group in the main chain and/or the side chain; and an infrared absorbing material.. ... Fujifilm Corporation

06/22/17 / #20170172400

Endoscope system

An endoscope system includes an endoscope having an image pickup section and a processor device for an endoscope, and optically communicates signals through a scope-side connector and a processor-side connector. In the endoscope system, an optical communication section is constituted by an image signal transmission section and an image signal reception section, and windows and are arranged. ... Fujifilm Corporation

06/15/17 / #20170171972

Transparent conductive film and method for producing transparent conductive film

. . A transparent conductive film comprises a transparent substrate and a metal wiring portion formed thereon. A thin metal wire contained in an electrode portion in the metal wiring portion has a surface shape satisfying the condition of ra2/sm>0.01 μm and has a metal volume content of 35% or more. ... Fujifilm Corporation

06/15/17 / #20170171460

Imaging device, imaging device body, and lens barrel

A distance-information acquisition unit acquires information about a distance to a subject in each focus detection region by setting a plurality of focus detection regions in an imaging region. A depth-of-field calculating unit calculates the depth of field for one major subject (principal object) on the basis of the information about a distance to the major subject, which is selected from a plurality of subjects, and a diaphragm value, which is corrected on the basis of optical characteristics of an apd filter. ... Fujifilm Corporation

06/15/17 / #20170171420

Image reading device and printing apparatus

There are provided an image reading device and a printing apparatus that can reduce an influence of the shadows of suction holes. Suction holes, which are used to suck a sheet, are arranged on the peripheral surface of a drum that transports the sheet. ... Fujifilm Corporation

06/15/17 / #20170168395

Active light sensitive or radiation sensitive resin composition, active light sensitive or radiation sensitive film, mask blank provided with active light sensitive or radiation sensitive film, pattern forming method, method for manufacturing electronic device, and electronic device

An actinic ray-sensitive or radiation-sensitive resin composition includes an alkali-soluble resin (a) and a compound (b) exemplified below, the compound (b) has a specific structure within a molecule.. . ... Fujifilm Corporation

06/15/17 / #20170168394

Active-light-sensitive or radiation-sensitive resin composition, pattern forming method, and method for manufacturing electronic device

The present invention has an object to provide an active-light-sensitive or radiation-sensitive resin composition having high dof and low lwr; a pattern forming method using the composition; and a method for manufacturing an electronic device. The active-light-sensitive or radiation-sensitive resin composition of the present invention includes a resin p and a compound that generates an acid upon irradiation with active light or radiation, in which the resin p has a repeating unit p1 and a repeating unit p2 represented by specific formulae, and the repeating unit p2 does not have a group in which a hydroxy group of a hydroxyadamantyl group is protected with a group that decomposes by the action of an acid to leave.. ... Fujifilm Corporation

06/15/17 / #20170168391

Photosensitive resin composition, method for producing cured film, cured film, liquid crystal display device, organic electroluminescent display device, and touch panel

There are provided a photosensitive resin composition having excellent chemical resistance, light resistance, and solubility in a solvent, a method for producing a cured film, a cured film, a liquid crystal display device, an organic electroluminescent display device, and a touch panel. The photosensitive resin composition contains a polybenzoxazole precursor, a photoacid generator which generates an acid having a pka of 3 or less or a quinone diazide compound, and a solvent, in which the polybenzoxazole precursor contains a total of 70 mol % or more of a repeating unit represented by the following formula (1) and a repeating unit represented by the following formula (2) with respect to the total repeating units, and a ratio between the repeating unit represented by formula (1) and the repeating unit represented by formula (2) is 9:1 to 3:7 in a molar ratio. ... Fujifilm Corporation

06/15/17 / #20170168295

Display apparatus

A display apparatus comprises a display device including an imagewise light emitting unit that emits imagewise light for displaying an input image, and a display surface member that includes a display surface that displays the input image as a displayed image, and transmits backside ambient light or reflects ambient light; an observation distance detecting section that detects an observation distance between the display surface and an observer; a display brightness acquiring section that acquires display brightness of the display device; an ambient light detecting section that detects the ambient light; and an image processing unit that performs image processing to adjust input spatial frequency characteristics of the input image based on the display brightness, the observation distance, and the ambient light such that display spatial frequency characteristics of the displayed image agree with target spatial frequency characteristics.. . ... Fujifilm Corporation

06/15/17 / #20170168274

Projection zoom lens and projection display apparatus

The present invention provides a projection zoom lens and a projection display apparatus including the projection zoom lens. The projection zoom lens substantially has a negative first lens group, a positive second lens group, a positive third lens group, a positive fourth lens group, and a positive fifth lens group in order from a magnification side. ... Fujifilm Corporation

06/15/17 / #20170168000

Gas sensor and organic transistor

The present invention provides a gas sensor which exhibits high detection sensitivity and includes an organic transistor and an organic transistor. A gas sensor of the present invention includes a bottom-gate type organic transistor including a source electrode, a drain electrode, a gate electrode, a gate insulating layer, an organic semiconductor layer, and a receptor layer which is disposed between the gate insulating layer and the organic semiconductor layer and includes a compound that interacts with gas molecules which are a detection subject.. ... Fujifilm Corporation

06/15/17 / #20170167965

Cell imaging apparatus and method

There is provided a cell imaging apparatus and method capable of generating a high-quality composite image as an image to be evaluated. The cell imaging apparatus includes: an imaging unit 10 that images a cell group including a plurality of periodically moving cells while changing an imaging range; a phase information acquisition unit 21 that acquires information based on the timing of the same phase in each period of the periodic movement; and a composite image generation unit 22 that generates a composite image by arranging images of the respective imaging ranges. ... Fujifilm Corporation

06/15/17 / #20170166948

Cell culture evaluation system and method

A cell culture evaluation system includes a cell culture device 10 culturing a plurality of cell culture units of which arrangements are changed; and a cell quality evaluation device 60 including a cell quality evaluation portion 61 that performs image-evaluation on qualities based on images of the cell culture units and a cell arrangement-position storage unit 64 that stores respective arrangement-positions of the cell culture units before and after the arrangement change. When portion of the cell culture units among the plurality of cell culture units are selected to be subjected to image-evaluation, if cell culture units of which results of the image-evaluation do not satisfy predetermined conditions exist, cell culture units, which have been arranged in a predetermined distance range from the cell culture units that do not satisfy the conditions, are specified and evaluated to a point of time of the image-evaluation based on the stored respective arrangement-positions.. ... Fujifilm Corporation

06/15/17 / #20170166766

Gel particles, photosensitive composition, ink composition, method of producing water dispersion of gel particles, and image forming method

Provided are gel particles each having a three-dimensional crosslinked structure having at least one bond selected from a urethane bond and a urea bond, the gel particles each including: a maleimide group represented by formula 1 below, a photosensitive composition, an ink composition, a method of producing water dispersion of gel particles, and an image forming method. In formula 1, r1 and r2 each independently represent a hydrogen atom or an alkyl group, r1 and r2 may be bonded to each other to form a ring, and * represents a bonding site.. ... Fujifilm Corporation

06/15/17 / #20170166762

Infrared shielding composition, infrared cut filter, and solid-state imaging device

The invention relates to provide an infrared shielding composition that can form an infrared cut filter in which flat coating properties are excellent and the generation of a pattern on the surface is suppressed and that has excellent drying resistance, an infrared cut filter, and a solid-state imaging device. The infrared shielding composition according to the invention includes at least metal containing tungsten oxide particles; a resin binder; a solvent a of which a boiling point is 170° c. ... Fujifilm Corporation

06/15/17 / #20170165988

Image forming apparatus

There is provided an image forming apparatus that can stably discharge liquid from a liquid discharge head and can be reduced in size by a simple structure. In an image forming apparatus, a gas compressor is provided so as to face the peripheral surface of an image forming drum , which corresponds to a range positioned outside a transport range in which a recording medium is transported and deviating from the transport range in a circumferential direction. ... Fujifilm Corporation

06/15/17 / #20170165959

Method for analyzing positional displacement between head modules, method for adjusting recording head, and image recording apparatus

The positional displacement shift amount between the head modules is calculated in a first dynamic range and with a first arithmetic accuracy, and calculated in a second dynamic range wider than the first dynamic range and with a second arithmetic accuracy rougher than the first arithmetic accuracy and finer than the first dynamic range, and as a positional displacement shift amount between the head modules in the first direction, the positional displacement shift amount with the second arithmetic accuracy is selected if the positional displacement shift amount with the second arithmetic accuracy exceeds the first dynamic range, and the positional displacement shift amount with the first arithmetic accuracy is selected if within the first dynamic range.. . ... Fujifilm Corporation

06/15/17 / #20170165262

Pharmaceutical composition for treating flt3 mutation-positive cancer, mutant flt3 inhibitor and uses thereof

Provided are a pharmaceutical composition for treating an flt3 mutation-positive cancer; a mutant flt3 inhibitor; and uses thereof. Disclosed are a pharmaceutical composition for treating an flt3 mutation-positive cancer, containing a compound represented by general formula [1] or a salt thereof as an active ingredient; a mutant flt3 inhibitor; an anticancer agent; a method for predicting a therapeutic effect by administration of a pharmaceutical composition containing a compound represented by general formula [1] or a salt thereof in a subject, including a step of detecting the presence or absence of an flt3 mutation; a method for selecting a subject to whom a pharmaceutical composition containing a compound represented by general formula [1] or a salt thereof is applied, including a step of detecting the presence or absence of an flt3 mutation; and a method for determining whether or not a pharmaceutical composition containing a compound represented by general formula [1] or a salt thereof is administered to a subject, including a step of detecting the presence or absence of an flt3 mutation.. ... Fujifilm Corporation

06/15/17 / #20170164609

Antibacterial sheet, antibacterial coat, laminate, and antibacterial solution

An object of the present invention is to provide an antibacterial sheet which is particularly extremely effective for preventing cloudiness or dew condensation and can prevent or inhibit the bacterial multiplication, an antibacterial coat, a laminate, and an antibacterial solution. The antibacterial sheet of the present invention has a support and at least one antibacterial layer disposed on the support, in which the antibacterial layer contains a binder and at least one kind of an antibacterial agent, and a water contact angle of only the binder is equal to or less than 20°.. ... Fujifilm Corporation

06/08/17 / #20170163919

Infrared imaging device, fixed pattern noise calculation method, and fixed pattern noise calculation program

. . . . . . . . An infrared imaging device includes an imaging element including a plurality of infrared detection pixels which are two-dimensionally arranged and an fpn calculation unit that selects a plurality of selected captured image data items from a plurality of captured image data items obtained by capturing an image of an object including a moving body, which moves with respect to the imaging element, using the imaging element, averages the plurality of selected captured image data items to generate average image data, and stores the average image data as fixed pattern noise which is output from the plurality of infrared detection pixels.. . ... Fujifilm Corporation

06/08/17 / #20170163915

Image processing apparatus, filter acquisition apparatus, image processing method, filter acquisition method, program, and recording medium

There are provided an image processing apparatus, an image processing method, and a program capable of realizing a desired image filtering process specified based on an optical characteristic of an individual optical system with high accuracy using a simple computation process. Further, there are provided a filter acquisition apparatus, a filter acquisition method, program, and a recording medium capable of acquiring a filter which is suitably usable in an image filtering process. ... Fujifilm Corporation

06/08/17 / #20170163899

Imaging device, imaging method, and program

An imaging device (pan/tilt camera) includes an imaging unit including an imaging lens and an imaging element, a pan/tilt mechanism that rotates the imaging unit in the horizontal direction and the vertical direction with respect to a camera body, an object detection unit that detects an object, which is a tracking target, from a moving image captured by the imaging unit, a pan/tilt control unit that controls the pan/tilt mechanism such that the object detected by the object detection unit is tracked, a motion sensor that detects a physical amount related to the movement of the camera body, and an operation control unit that stops the pan/tilt mechanism in a case in which the physical amount detected by the motion sensor is equal to or greater than a first threshold value.. . ... Fujifilm Corporation

06/08/17 / #20170163884

Infrared imaging device, fixed pattern noise calculation method, and fixed pattern noise calculation program

An infrared imaging device includes an imaging element including a plurality of infrared detection pixels which are two-dimensionally arranged, a diaphragm, and a fpn calculation unit which acquires a first captured image data obtained by capturing an image using the imaging element in a state in which an f-number of the diaphragm is set to a first value and a second captured image data obtained by capturing an image using the imaging element in a state in which the f-number is set to a second value while a motion picture is being captured, and calculates fixed pattern noise included in captured image data obtained by capturing an image using the imaging element based on the acquired first captured image data, the acquired second captured image data, the first value, and the second value.. . ... Fujifilm Corporation

06/08/17 / #20170163881

Imaging control device, imaging control method, camera, camera system, and program

An imaging control device according to an aspect of the present invention comprises a motion vector calculation unit that calculates a motion vector of a tracking target on the basis of a moving image obtained by an imaging unit, a tracking direction instruction input unit that receives an input of a tracking direction instruction indicating a specific tracking direction for tracking the tracking target, a tracking direction motion component extraction unit that extracts a motion component in the specific tracking direction from the motion vector of the tracking target on the basis of the tracking direction instruction; and a drive information generation unit that generates drive information of only the specific tracking direction of a pan and tilt mechanism on the basis of the extracted motion component in the specific tracking direction.. . ... Fujifilm Corporation

06/08/17 / #20170163880

Moving image editing device, moving image editing method, moving image editing program

A smartphone which functions as a moving editing device includes: a wireless communication unit that is connected to plural cameras capable of performing moving image capturing in a wireless manner and acquires one or plural live view images from the plural cameras; a display panel that displays the acquired one or plural live view images; an operation panel that performs switching between live view images displayed on the display panel by a manual operation; a storage unit that stores operation history information indicating an operation history in the operation panel; and a main controller which functions as a moving image editing unit that performs moving image editing for automatically creating, after the moving image capturing in the plural cameras is terminated, one moving image based on plural moving images respectively captured by the plural cameras and the operation history information stored in the storage unit.. . ... Fujifilm Corporation

06/08/17 / #20170163871

Imaging control device, imaging device, imaging control method, and program

An imaging control device 100 includes a control communication unit 110 that communicates with a plurality of imaging devices and an overall control unit 101. The overall control unit 101 transmits an imaging preparation command to prepare imaging to each of the plurality of imaging devices 10 through the control communication unit 110 in response to an instruction received through an instruction receiving unit, receives preparation completion information indicating the completion of preparation for imaging from each of the plurality of imaging devices 10 through the control communication unit 110, and transmits a captured image acquisition command to acquire a captured image to each of the plurality of imaging devices 10 through the control communication unit 110 after receiving the preparation completion information from the plurality of imaging devices 10.. ... Fujifilm Corporation

06/08/17 / #20170162133

Backlight unit and liquid crystal display device

An aspect of the present invention relates to a backlight unit, including: a polarized light source unit which is capable of allowing polarized light to exit; and a condensing sheet which is disposed on the polarized light source unit on an exiting side, in which a depolarization degree of the condensing sheet is less than or equal to 0.1500, and a liquid crystal display device, including: the backlight unit; and a liquid crystal panel.. . ... Fujifilm Corporation

06/08/17 / #20170161877

Image processing apparatus, image processing method, program, and recording medium

There are provided an image processing apparatus, an image processing method, a program, and a recording medium capable of compatibly achieving a high-accuracy filtering process and reduction in a necessary storage capacity. An image processing apparatus includes a filtering process unit that performs an image filtering process including a plurality of filtering processes. ... Fujifilm Corporation

06/08/17 / #20170161468

Cell information acquisition apparatus, cell information acquisition method, and cell information acquisition program

The invention provides a cell information acquisition apparatus, a cell information acquisition method, and a cell information acquisition program capable of securing, when forming a tissue or the like using a plurality of cells, traceability of culture information of cells that form the tissue, or the like. The cell information acquisition apparatus includes an additional information acquisition unit 51 that acquires additional information assigned to a plurality of cell culture units; and an integrated information acquisition unit 52 that acquires, when integrating cells respectively cultured in the plurality of cell culture units to create an integrative cell culture unit, integrated information relating to the integrative cell culture unit by integrating the additional information of the respective cell culture units.. ... Fujifilm Corporation

06/08/17 / #20170160837

Method for manufacturing laminate containing patterned layers to be plated, method for manufacturing metal layer-containing laminate, touch panel sensor, touch panel, laminate containing patterned layers to be plated, and metal layer-containing laminate

A method for manufacturing a laminate containing patterned layers to be plated includes a step of preparing a laminate having a substrate having two main surfaces, and layers for forming a layer to be plated, respectively disposed on two main surfaces of the substrate and containing a polymerization initiator, a step of irradiating a layer for forming a layer to be plated in the laminate with light in a patternwise fashion under a predetermined requirement, and a step of removing non-light irradiated regions in the layers for forming a layer to be plated, thereby forming patterned layers to be plated on two main surfaces of the substrate. Also set forth are a touch panel sensor, a touch panel, a laminate containing patterned layers to be plated, and a metal layer-containing laminate.. ... Fujifilm Corporation

06/08/17 / #20170160515

Camera apparatus, camera body, interchangeable lens, and method of controlling operation of camera body

The invention speeds up operation of an interchangeable lens. The interchangeable lens, which is removably mounted on a camera body, includes a communication control microcomputer, a lens driving circuit and a lens driving actuator. ... Fujifilm Corporation

06/08/17 / #20170160452

Optical film, illumination device, and image display device

An optical film having a positive c-plate sandwiched by circular polarization reflection layers with different center wavelength of reflection band, wherein the circular polarization reflection layer closest to a light exit side of the optical film does not have the shortest center wavelength of reflection band among the circular polarization reflection layers, can suppress an oblique tint change when the optical film is incorporated into a liquid crystal display device.. . ... Fujifilm Corporation

06/08/17 / #20170160438

Antireflection film and optical member including antireflection film

The antireflection film is provided on a surface of a light-transmitting substrate and includes a thin multi-layer film and a fine unevenness layer that are laminated in this order from the substrate side. The thin multi-layer film includes multiple layers. ... Fujifilm Corporation

06/08/17 / #20170160436

Antireflection film, lens, and imaging device

In the antireflection film, a hydrogenated carbon film as a first layer is formed on a surface of an optical substrate. A mgf2 film as a second layer having a lower refractive index than the first layer is formed on the first layer and functions as a low refractive index layer. ... Fujifilm Corporation

06/08/17 / #20170159124

Examination notification output device, examination notification output method, examination notification output program, and gene chromosome examination system

There are provided an examination notification output device, an examination notification output method, an examination notification output program, and a gene chromosome examination system capable of outputting information, which is an indicator for determining whether or not a re-examination is required, in a case where it is determined that a re-examination is required for a gene chromosome examination. An examination notification output device that outputs an examination notification of a gene chromosome examination for examining the abnormalities of chromosomes included in embryonic cells includes: an information acquisition unit that acquires information including an examination result of a gene chromosome examination; an examination notification generation unit that generates an examination notification by adding re-examination necessity determination information that is used in determining whether or not a re-examination is required; and an examination notification output unit that outputs the generated examination notification.. ... Fujifilm Corporation

06/08/17 / #20170158998

Cell culture observation device and method

A cell culture observation device and a cell culture observation method which observe a plurality of culture containers and perform operations for each culture container capture an image without blurring caused by the operations for the culture container and improve the throughput of processing for the plurality of culture containers. The cell culture observation device includes a cell observation unit 30 that observes cells in each of a plurality of culture containers in which the cells are cultured, an operating unit 20 that performs a plurality of operations for each of the culture containers, and an operation content determination unit 41 that determines the content of an operation which can be performed for culture containers other than a culture container to be observed while the culture container to be observed is being observed among the plurality of operations.. ... Fujifilm Corporation

06/08/17 / #20170158896

Printing process

A process for printing on a water-soluble material using a self-dispersible pigment which comprises a carboxy-functional dispersant crosslinked around a pigment core by a crosslinking agent having at least two groups selected from oxetane, carbodiimide, hydrazide, oxazoline, aziridine, isocyanate, n-methylol, keteneimine, isocyanurate and epoxy groups. Also inks, ink-sets, printed material and ink-jet printers.. ... Fujifilm Corporation

06/08/17 / #20170157919

Image processing device, image processing method, and ink jet recording apparatus

Provided are an image processing device, an image processing method, and an ink jet recording apparatus that can prevent the occurrence of density unevenness, such as banding, regardless of a duty, without causing deterioration of image quality. A jetting rate indicating an ink jetting rate of each of a plurality of nozzles which jet ink in a recording head including the nozzles is determined. ... Fujifilm Corporation

06/08/17 / #20170157900

Cellulose acylate film, manufacturing method of cellulose acylate film, laminate, polarizing plate, and liquid crystal display device

The present invention provides a cellulose acylate film, containing: an organic acid satisfying requirements of a to c, in which a film thickness of the cellulose acylate film is greater than or equal to 3 μm, and an average concentration of the organic acid in a region from one surface of the cellulose acylate film to a depth of 0 to 0.2 λm is lower than an average concentration of the organic acid in a residual region other than the region: a: having a structure in which polyhydric alcohol and a polyvalent carboxylic acid are bonded by forming an ester bond; b: the total number of molecules of polyhydric alcohol and a monovalent or more carboxylic acid forming the organic acid being greater than or equal to 3; and c: having at least one non-substituted carboxyl group derived from a polyvalent carboxylic acid.. . ... Fujifilm Corporation

06/08/17 / #20170157899

Transfer film, method for manufacturing laminate, laminate, electrostatic capacitance-type input device, and image display device

In a transfer film including a temporary support having a thickness of 38 μm or less; and a curable transparent resin layer disposed on the temporary support in a direct-contact manner, in which a thickness of the curable transparent resin layer is 5 μm or more, the curable transparent resin layer includes a binder polymer, a polymerizable compound, and a polymerization initiator, and a melt viscosity ηc of the curable transparent resin layer measured at 100° c. Is 1.0×103 pa·s or more, the temporary support and the curable transparent resin layer are in direct contact with each other, and it is possible to prevent the incorporation of air bubbles during lamination on base materials having an elevation difference; a method for manufacturing a laminate; a laminate; an electrostatic capacitance-type input device; and an image display device.. ... Fujifilm Corporation

06/01/17 / #20170155832

Method of setting initial position of camera, camera, and camera system

. . . . . . In one aspect of the present invention, when reset of a camera is received, a pan motor and a tilt motor of a pan and tilt mechanism are rotated in a first preset rotation direction, and the pan and tilt mechanism is first moved to a pan reference position and a tilt reference position. Thereafter, the pan motor and the tilt motor are rotated in a second rotation direction opposite to the first rotation direction, and the pan and tilt mechanism is moved to an initial pan position and an initial tilt position. ... Fujifilm Corporation

06/01/17 / #20170155828

Imaging device operation device, operation method, and program

Provided are an imaging device operation device, an operation method, and a program that can simply and rapidly operate a pan/tilt mechanism such that an imaging unit is located at a desired position. A pan/tilt operation device includes a touch panel in which a touch centering detection region is set, predetermined pan angle rotation instruction regions are set on the left and right sides of the touch centering detection region, and predetermined tilt angle rotation instruction regions are set on the upper and lower sides of the touch centering detection region, a touch centering instruction unit, a predetermined pan angle rotation instruction unit that outputs an instruction to pan a pan/tilt mechanism at a predetermined pan angle, and a predetermined tilt angle rotation instruction unit that outputs an instruction to tilt the pan/tilt mechanism at a predetermined tilt angle.. ... Fujifilm Corporation

06/01/17 / #20170155821

Imaging device and imaging method

An imaging device includes an imaging optical system that includes a first optical system and a second optical system having independent characteristics; an imaging element that includes plural light-receiving sensors that pupil-split light passed through a corresponding optical system among the first optical system and the second optical system to receive the light; an image generation unit that generates a first captured image from an imaging signal output from the light-receiving sensors corresponding to the first optical system and generates a second captured image from an imaging signal output from the light-receiving sensors corresponding to the second optical system; a focus adjustment unit that adjusts a focus state of each of the first optical system and the second optical system in an independent manner; and a focus controller that controls the focus adjustment unit based on importance degree information.. . ... Fujifilm Corporation

06/01/17 / #20170155067

Method of manufacturing semiconductor device and semiconductor device

Disclosed are a manufacturing method capable of manufacturing a semiconductor device having a plurality of organic semiconductor elements with a simple process and high productivity, and a semiconductor device. This problem is solved by forming, on an insulating substrate, electrodes corresponding to a plurality of semiconductor elements, in which the position of an uppermost portion of each of a source electrode and a drain electrode is higher than that of a gate electrode, forming an organic semiconductor film on a surface of an insulating support, forming grooves in the organic semiconductor film to form divided regions according to the individual semiconductor elements, and aligning and laminating the insulating support and the insulating substrate.. ... Fujifilm Corporation

06/01/17 / #20170154704

Transfer material, method of manufacturing transfer material, laminated body, method of manufacturing laminated body, method of manufacturing capacitance-type input device, and method of manufacturing image display device

A transfer material and a method of manufacturing the same, the transfer material including, in this order, a temporary support body, a first resin layer, and a second resin layer, the first resin layer not being water soluble, the second resin layer including a water soluble polymer, the second resin layer including a compound that has a heteroaromatic ring including a nitrogen atom as a ring member, and a content of the compound that has a heteroaromatic ring including a nitrogen atom as a ring member in the second resin layer being 3.0% by mass or greater with respect to a total solid content of the second resin layer. A laminated body including a substrate; an electrode pattern that is positioned above the substrate and that includes a metal in at least part of the electrode pattern; a second resin layer positioned above the electrode pattern; and a first resin layer positioned above the second resin layer, the second resin layer including a compound that has a heteroaromatic ring including a nitrogen atom as a ring member.. ... Fujifilm Corporation

06/01/17 / #20170153545

Pattern forming method, method for manufacturing electronic device, and electronic device

There is provided a pattern forming method including (1) a step of forming a film with an active-light-sensitive or radiation-sensitive resin composition containing the following (a) to (c): (a) a resin having a repeating unit having a phenolic hydroxyl group, and having a group that decomposes by the action of an acid to generate a polar group, (b) a compound that generates an acid upon irradiation with active light or radiation, and (c) a compound having a cationic site and an anionic site in the same molecule, in which the cationic site and the anionic site are linked to each other via a covalent bond; (2) a step of exposing the film; and (3) a step of developing the exposed film using a developer including an organic solvent to form a negative tone pattern.. . ... Fujifilm Corporation

06/01/17 / #20170153544

Photosensitive composition, method for producing cured film, cured film, touch panel, and display device

A photosensitive composition, a method for producing a cured film using the photosensitive composition, a cured film prepared by curing the photosensitive composition, and a touch panel and a display device that use the cured film are provided. The photosensitive composition contains: a compound having two or more ethylenically unsaturated groups; a photopolymerization initiator; a polymer a1 containing a constitutional unit a1 represented by the following formula 1 and a constitutional unit a2 having a carboxylic acid anhydride structure; particles; and a solvent. ... Fujifilm Corporation

06/01/17 / #20170153526

Reflective display device

A reflective display device including electrophoresis display unit including an electrophoresis display layer and radiation unit which includes a primary light source that emits light in a previously-specified wavelength range and a light conversion portion including quantum dots that convert the light in a previously-specified wavelength range to white light and radiates the white light to the electrophoresis display layer from a viewer side of electrophoresis display unit.. . ... Fujifilm Corporation

06/01/17 / #20170153446

Lens device

There is provided a lens device that prevents dust from entering a space in which a movable lens is moved. A movable lens is moved in the direction of an optical axis. ... Fujifilm Corporation

06/01/17 / #20170153411

Lens device

A lens device includes a hall ic detecting whether extender lenses are positioned on an optical axis or are retreated from the optical axis by rotating the extender lenses about a rotating shaft by a predetermined angle. An inner space of a lens barrel is divided into first to fourth spaces by a first plane passing through the rotating shaft and the optical axis and a second plane passing through the optical axis and perpendicular to the first plane. ... Fujifilm Corporation

06/01/17 / #20170153370

Optical laminate, polarizing plate and organic el display device

The present invention provides an optical laminate in which cissing occurring when an optically anisotropic layer is formed and film thickness unevenness are suppressed, and a polarizing plate and an organic el display device using the same. The optical laminate includes an optically anisotropic layer a, and an optically anisotropic layer b, where layer a and layer b come into direct contact, either or both of layer a and layer b are formed of a composition containing a liquid crystal compound, surface energy a of a surface of layer a on a side in contact with layer b is 30 to 40 mn/m, surface energy b1 of a surface of layer b on a side in contact with layer a is 35 mn/m or more, and surface energy b2 of a surface of layer b opposite to the side in contact with layer a is 25 mn/m or less.. ... Fujifilm Corporation

06/01/17 / #20170153369

Method of producing optical laminate, optical laminate, polarizing plate and organic el display device

The present invention provides an optical laminate which is suppressed in film thickness unevenness of an optically anisotropic layer and is free from point defects, a method of producing the same, and a polarizing plate and an organic el display device using the optical laminate. The method of producing an optical laminate having an optically anisotropic layer a and an optically anisotropic layer b, includes where the layer a and the layer b are provided in direct contact with each other. ... Fujifilm Corporation

06/01/17 / #20170152555

Method for detecting presence or absence of heteroploidy of fetal chromosome

A method for detecting the presence or absence of heteroploidy of fetal chromosomes includes: obtaining a primary amplification products by amplifying chromosomal dna obtained from a biological sample collected from a pregnant mother; performing multiplex amplification of a plurality of target regions to obtain a secondary amplification product using the primary amplification product as a template; adding a label to both terminals of the secondary amplification product to obtain the labeled secondary amplification product; performing amplification using a primer pair annealing to the label using the labeled secondary amplification product as a template to obtain a tertiary amplification product; and determining the amplification amount and base sequences of the plurality of target regions from the tertiary amplification product. The primary amplification amplifies the total amount of dna by 6000 to 30000 times, and the secondary amplification step amplifies the total amount of dna by 3 to 150 times.. ... Fujifilm Corporation

06/01/17 / #20170152362

Functional polymer membrane, stack or device provided with functional polymer membrane, and method of producing functional polymer membrane

Provided is a functional polymer membrane including a porous support; and a resin layer and an auxiliary layer which are supported by the porous support, in which both of the resin layer and the auxiliary layer contain an ion exchange polymer having one of an anion exchange group and a cation exchange group, a charge of the ion exchange group of the ion exchange polymer included in the resin layer is opposite to a charge of the ion exchange group of the ion exchange polymer included in the auxiliary layer, and both of the ion exchange polymers respectively included in the resin layer and the auxiliary layer are polymers having a unit obtained from an acryloyl group which may have an alkyl group at the α-position; a stack or a device provided with a functional polymer membrane; and a method of producing, a functional polymer membrane.. . ... Fujifilm Corporation

06/01/17 / #20170152361

Functional polymer membrane, production method thereof, and stack or device provided with functional polymer membrane

Provided are a functional polymer membrane including: a surface layer; and an anion exchange membrane or a cation exchange membrane, in which the surface layer contains a polymer which includes a cross-linked structure having, in a cross-linking unit, an ionic group with a charge opposite to a charge of an ionic group included in at least one of the anion exchange membrane or the cation exchange membrane; a production method thereof, and a stack or a device provided with a polymer functional membrane.. . ... Fujifilm Corporation

06/01/17 / #20170151811

Medium conveying device and image recording apparatus

There are provided a medium conveying device and an image recording apparatus that can convey a medium without the generation of wrinkles and floating. Projections having the same size are regularly disposed on the peripheral surface of an image recording drum to form recessed portions and protruding portions on the peripheral surface of the image recording drum. ... Fujifilm Corporation

06/01/17 / #20170151790

Nozzle wiping sheet, nozzle wiping unit, and image forming apparatus

Provided are a nozzle wiping sheet, a nozzle wiping unit, and an image forming apparatus capable of preventing occurrence of streaks during printing immediately after maintenance. A wiping member (120) wipes a nozzle surface (57k) of a jetting head (56k) provided with a nozzle through which liquid droplets are jetted, in which a shape of the liquid droplet added dropwise to the wiping member (120) after a cleaning liquid (108) is added to the wiping member (120) satisfies the following condition when an aspect ratio of the liquid droplet after 40 seconds after the addition of the cleaning liquid (108) is assumed to be r, and the r is 1.3 or more.. ... Fujifilm Corporation

06/01/17 / #20170151789

Wiping mechanism, liquid droplet jetting apparatus, and wiping method

Provided are a wiping mechanism, a liquid droplet jetting apparatus, and a wiping method capable of preventing infiltration of bubbles into a nozzle when a nozzle surface is wiped by a wiping member. A wiping member (200) comes into contact with a nozzle surface (78) with a nozzle through which liquid droplets are jetted and is formed by weaving weft yarns (220) and warp yarns (210), in which the wiping member (200) in which the weft yarns (220) are further exposed to the nozzle surface (78a) side than the warp yarns (210) is moved relative to the nozzle surface (78a) along the warp yarns (210).. ... Fujifilm Corporation

06/01/17 / #20170151754

Optical member including antireflection film and method of manufacturing the same

The optical member includes: a transparent substrate; and an antireflection film that is formed on surface, in which the antireflection film includes a fine unevenness layer and an interlayer, the fine unevenness layer includes an alumina hydrate as a major component and has a uneven structure having a shorter distance between convex portions than a wavelength of antireflection target light, the interlayer is disposed between the fine unevenness layer and the transparent substrate, a peak value of spatial frequency of the uneven structure in the fine unevenness layer is higher than 6.5 μm−1, and the interlayer includes at least three layers alternately including a low refractive index layer and a high refractive index layer.. . ... Fujifilm Corporation

05/18/17 / #20170142387

Image processing device, imaging device, image processing method, and program

. . An image processing unit (31) according to a preferred aspect of the invention includes an image acquisition unit (41) that acquires a first image signal indicating a first flash emission image which is captured by a main imaging operation while flash light is emitted and a second image signal indicating a second flash emission image which is obtained by capturing the same scene as that of the first flash emission image with an exposure time different from an exposure time of the first flash emission image, using a reference imaging operation, while the flash light is emitted, a ratio calculation unit (43) that calculates a ratio of the first image signal to the second image signal in each region, and a determination unit (45) that determines a main object region and a background region on the basis of a threshold value.. . ... Fujifilm Corporation

05/18/17 / #20170140203

Method, apparatus, and program for judging grid quality

An image obtaining section obtains a radiation image that includes a periodic pattern of a grid. A frequency analyzing section performs frequency analysis on the radiation image to obtain a frequency spectrum of the radiation image. ... Fujifilm Corporation

05/18/17 / #20170139516

Laminate structure and touch panel module

A laminate structure includes a laminate which has a three-dimensional shape and is provided with a transparent conductive member having a plurality of conductive layers constituted of fine metal wires on a flexible transparent substrate, a wiring formed on the transparent substrate and electrically connected to each conductive layer, a protective member having an optically transparent region and protecting the transparent conductive member, and an optically transparent adhesive layer positioned between the transparent conductive member and the protective member. The laminate has at least a planar portion and a bent portion formed continuously to the planar portion. ... Fujifilm Corporation

05/18/17 / #20170137444

Composition, cured film, near infrared ray absorption filter, solid-state imaging device, infrared sensor, and compound

It is possible to provide a composition that has absorption in a near infrared region and that can form a film having transparency in a visible region. Provided are a cured film, a near infrared ray absorption filter, a solid-state imaging device, an infrared sensor, and a compound. ... Fujifilm Corporation

05/18/17 / #20170136740

Heat insulating window film, heat insulating window glass, and window

There is provided a heat insulating window film disposed on the inside of a window, including: a support; and a fibrous conductive particles-containing layer disposed on the support, in which the fibrous conductive particles-containing layer contains fibrous conductive particles, the fibrous conductive particles-containing layer is disposed on a surface of the support on a side opposite to the surface of the window side, and a resistivity of the fibrous conductive particles-containing layer is equal to or greater than 1,000 Ω/□. The heat insulating window film is a heat insulating window film having excellent heat insulating properties and radio-wave transmittance. ... Fujifilm Corporation

05/18/17 / #20170136727

Conductive film laminate, conductor, manufacturing method of conductor

A conductive film laminate includes: an insulating support having a flat plate shape; and a conductive film which is bonded onto a surface of the support with an adhesive, in which the conductive film includes an insulating substrate having flexibility and a conductive layer which is disposed on a surface of the insulating substrate, and the insulating substrate includes at least one opening formed by cutout of a portion where forming strain is concentrated, when forming the conductor, and the opening is covered with the support.. . ... Fujifilm Corporation

05/18/17 / #20170136709

Support structures design device and method, program, structure forming apparatus, and structure manufacturing method

There are provided a support structures design device and method, a non-transitory computer readable recording medium storing a program, a structure forming apparatus, and a structure manufacturing method capable of appropriately adding the data of a support structures to the three-dimensional data of a luminal structure. The up-and-down direction of a luminal structure is determined, the core line of the luminal structure is extracted, a lowermost point of a cross section of the luminal structure by a plane perpendicular to a tangential direction at a point, which corresponds to each of a plurality of points on the core line, on a projected core line is extracted as a support point, and three-dimensional data is generated by adding the data of a support structures for supporting the support point to three-dimensional data.. ... Fujifilm Corporation

05/11/17 / #20170133717

All solid-state secondary battery, electrode sheet for battery, method for manufacturing electrode sheet for battery, solid electrolyte composition, method for producing solid electrolyte composition, and method for manufacturing all solid-state secondary battery

. . . . . . An all solid-state secondary battery having a positive electrode active material layer; an inorganic solid electrolyte layer; and a negative electrode active material layer in this order, in which at least one layer of the positive electrode active material layer, the inorganic solid electrolyte layer, or the negative electrode active material layer includes a crosslinked polymer of a cyclic compound having a siloxane bond; and an inorganic solid electrolyte which includes a metal belonging to group i or ii of the periodic table and has an ion-conducting property respectively, an electrode sheet for a battery, a method for manufacturing an electrode sheet for a battery, a solid electrolyte composition, a method for producing a solid electrolyte composition, and a method for manufacturing an all solid-state secondary battery.. . ... Fujifilm Corporation

05/11/17 / #20170133713

All solid-state secondary battery, electrode sheet for battery, method for manufacturing electrode sheet for battery, solid electrolyte composition, method for producing solid electrolyte composition, and method for manufacturing all solid-state secondary battery

An all solid-state secondary battery having a positive electrode active material layer, an inorganic solid electrolyte layer, and a negative electrode active material layer in this order, in which at least one layer of the positive electrode active material layer, the inorganic solid electrolyte layer, or the negative electrode active material layer includes at least one cyclic compound having a siloxane bond and an inorganic solid electrolyte which includes a metal belonging to group i or ii of the periodic table and has an ion-conducting property, an electrode sheet for a battery, a method for manufacturing an electrode sheet for a battery, a solid electrolyte composition, a method for producing a solid electrolyte composition, and a method for manufacturing an all solid-state secondary battery.. . ... Fujifilm Corporation

05/11/17 / #20170133712

All solid-state secondary battery, solid electrolyte composition, electrode sheet for battery using same, method for manufacturing electrode sheet for battery, and method for manufacturing all solid-state secondary battery

An all solid-state secondary battery including: a positive electrode active material layer, a negative electrode active material layer, and a solid electrolyte layer, in which at least any one of the positive electrode active material layer, the negative electrode active material layer, or the solid electrolyte layer includes an inorganic solid electrolyte having a property of conducting ions of a metal belonging to group i or ii of the periodic table and a binder constituted of a specific high-molecular-weight compound.. . ... Fujifilm Corporation

05/11/17 / #20170133531

Solar cell rear surface protective sheet and solar cell module

Provided are a solar cell rear surface protective sheet comprising: a base material film including a white polyester film and having a thickness of from 20 μm to 500 μm, a first resin layer having a modulus of tensile elasticity of 1.2 gpa or higher and 3.0 gpa or lower and a thickness of 1 μm or greater, and a second resin layer having a lower modulus of tensile elasticity than the first resin layer, which are laminated in this order.. . ... Fujifilm Corporation

05/11/17 / #20170131885

Image retrieval condition setting device, image retrieval condition setting method, image retrieval apparatus, image retrieval method, program, and recording medium

In the image retrieval condition setting device, a numerical value range determination unit determines, with respect to at least one of plural retrieval conditions for retrieving an image from plural images, a numerical value range of the retrieval condition according to the plural images. A display control unit displays a slide region indicating the numerical value range of the retrieval condition on the display unit and displays a button region that moves on the slide region on the display unit according to an instruction of a user, for each retrieval condition. ... Fujifilm Corporation

05/11/17 / #20170131814

Substrate with decorative material, transfer material for forming decorative layer, touch panel, and information display device

A substrate with a decorative material includes a substrate, a white colored layer, and a light shielding layer in this order, and the light shielding layer contains a black pigment and a graft type silicone polymer. It is preferable that the graft type silicone polymer is a compound represented by formula 1 described below.. ... Fujifilm Corporation

05/11/17 / #20170131804

Conductive film and display device provided with touch panel

An object of the present invention is to provide a conductive film including a polarizer in which performance deterioration of the polarizer is suppressed while suppressing cracking of the polarizer due to a change in moisture heat environment; and a display device provided with a touch panel including the conductive film. The conductive film of the present invention includes a polarizer; and a conductive layer which is disposed on the polarizer and includes fullerene functionalized carbon nanotubes.. ... Fujifilm Corporation

05/11/17 / #20170131088

Distance measurement device, distance measurement method, and distance measurement program

A distance measurement device includes an imaging unit which captures a subject image formed by an imaging optical system, an emission unit which emits directional light as light having directivity along an optical axis direction of the imaging optical system, a light receiving unit which receives reflected light of the directional light from the subject, a derivation unit which derives a distance to the subject based on the timing at which the directional light is emitted and the timing at which the reflected light is received, a display unit which displays the subject image, and a control unit which performs control such that, in a case of performing a distance measurement, the display unit displays the subject image as a motion image and transition is made to a state where actual exposure by the imaging unit is possible at the timing of the end of the distance measurement.. . ... Fujifilm Corporation

05/11/17 / #20170130364

Nanofiber manufacturing method and nanofiber manufacturing device

The present invention provides a nanofiber manufacturing method and a nanofiber manufacturing device. A solution 25 in which a polymer is dissolved in a solvent is supplied from a distal end of a nozzle 16 to form a taylor cone 44 at a distal end opening 16b. ... Fujifilm Corporation

05/11/17 / #20170129933

Purification of tgf-beta superfamily proteins

Methods of purifying tgf-β superfamily proteins, including osteogenic proteins such as bone morphogenetic proteins (bmps), are disclosed.. . ... Fujifilm Corporation

05/11/17 / #20170129258

Ink jet recording apparatus and ink jet recording method

The ink jet recording apparatus includes: transport means that transports paper having a recording surface, on which an image is formed using an aqueous ink, along a transport path; heating means that is provided along the transport path; guide means that is provided along the transport path and supports the paper using a guide surface having suction holes; and suction means that suctions the paper through the suction holes of the guide surface, a suction region and a non-suction region are set when the paper is transported, the suction region in which the paper is suctioned by the suction means is set upstream of a first position of the transport path, the non-suction region is set downstream of the first position, and the first position is set at a position in which a residual water content in the paper is 1.0 g/m2 to 3.0 g/m2.. . ... Fujifilm Corporation

05/11/17 / #20170129252

High height ink jet printing

A system includes a print head including multiple nozzles formed in a bottom surface of the print head. The nozzles are configured to eject a liquid onto a substrate. ... Fujifilm Corporation

05/11/17 / #20170129231

Laminated polyester film and a production method thereof, solar cell protective sheet, and solar cell module

An embodiment of the present invention provides a laminated polyester film including: a biaxially oriented polyester film which is produced by stretching an un-stretched polyester film in a first direction and stretching the resultant in a second direction perpendicular to the first direction along a film surface and has a small endothermic peak temperature of 160° c. Or higher and 210° c. ... Fujifilm Corporation

05/11/17 / #20170128049

Ultrasound diagnostic apparatus and ultrasound image producing method

Disclosed are an ultrasound diagnostic apparatus and an ultrasound image producing method capable of producing a spatial compound image with reduced artifacts. Reception data of frame images is repeatedly acquired in a data acquisition cycle of four frames such that, of three frame images for use in producing a spatial compound image, the angle difference in steering angle between two frames for which the acquisition of reception data is most temporally separated is smaller than a maximum value among the angle differences in steering angle between two frame images among three frame images having different steering angles, and each time reception data of two frame images or reception data of another two frame images is acquired, three frame images sequentially produced based on reception data for three frames sequentially acquired hitherto are synthesized to produce a spatial compound image.. ... Fujifilm Corporation

05/11/17 / #20170128048

Ultrasound diagnostic apparatus and ultrasound image producing method

Disclosed are an ultrasound diagnostic apparatus and an ultrasound image producing method capable of producing a spatial compound image with reduced artifacts. Reception data of frame images is repeatedly acquired in a data acquisition cycle of four frames such that, of three frame images for use in producing a spatial compound image, the angle difference in steering angle between two frames for which the acquisition of reception data is most temporally separated is smaller than a maximum value among the angle differences in steering angle between two frame images among three frame images having different steering angles, and each time reception data of two frame images or reception data of another two frame images is acquired, three frame images sequentially produced based on reception data for three frames sequentially acquired hitherto are synthesized to produce a spatial compound image.. ... Fujifilm Corporation

05/11/17 / #20170128044

Ultrasonic endoscope and method of manufacturing the same

The present invention provides an ultrasonic endoscope in which the position of an ultrasonic oscillator can be easily adjusted with respect to a surgical-tool guide opening provided to a leading end part body of an insertion unit, and a method of manufacturing the ultrasonic endoscope. According to the present invention, an ultrasonic oscillator can be positioned with respect to and temporarily fixed to an ultrasonic-oscillator housing part by using spacers and or protrusions. ... Fujifilm Corporation

05/11/17 / #20170128043

Ultrasonic endoscope and method of manufacturing the same

The present invention provides an ultrasonic endoscope in which wiring can be reliably fixed to a wire housing space of an ultrasonic-oscillator housing part, and a method of manufacturing the ultrasonic endoscope. According to the present invention, a wire housing space is encapsulated from the outside by sealing a gap formed between an ultrasonic oscillator and an ultrasonic-oscillator housing part with sealing members. ... Fujifilm Corporation

05/11/17 / #20170127950

Acoustic wave detection probe and photoacoustic measurement apparatus provided with the same

In an acoustic wave detection probe provided with a light guide section that guides measuring light such that the measuring light is outputted toward a subject and an acoustic wave transducer that detects a photoacoustic wave generated in the subject by the projection of the measuring light, the light guide section includes a homogenizer that flat-tops an energy profile of the measuring light entered from the upstream side of the optical system, a light condensing member that condenses the measuring light transmitted through the homogenizer, and a bundle fiber which includes a plurality of optical fibers and is disposed such that the measuring light transmitted through the light condensing member enters from an entrance end of the bundle fiber.. . ... Fujifilm Corporation

05/11/17 / #20170127926

Endoscope system and light source device

Violet narrowband light vn and green narrowband light gn produced by a light source device are supplied to a complementary color type endoscope, and simultaneously applied to an observation object. In a complementary color type imaging device, first mixed pixels and second mixed pixels, which sense both of the violet narrowband light vn and the green narrowband light gn, are read out. ... Fujifilm Corporation

05/11/17 / #20170127920

Endoscope

A fixing sleeve that is fitted outward on a connecting portion between a connecting pipe and a treatment tool inserting tube for fixation of the connecting portion comprises a cylindrical sleeve body, an arc-shaped portion that is connected to a proximal end side of the sleeve body, is formed to be coaxial with a sleeve center axis of the sleeve body and has a center angle smaller than 180°, and a projection portion that is formed along a peripheral direction of the sleeve center axis on an inner peripheral surface in the arc-shaped portion in a radial inside of the sleeve center axis. A part of the treatment tool inserting tube is flexibly deformed in a convex shape by the projection portion, and the part thereof is supported by the projection portion.. ... Fujifilm Corporation

05/11/17 / #20170127910

Endoscope and hardness adjustment device

Provided are an endoscope and a hardness adjustment device configured so that an arrangement space of built-in components in an operation portion can be ensured and that burden on a coil spring and a wire can be reduced. In an operation portion, a retained portion of a coil spring unit is retained at a first radial position by a coil spring holder as a first retainer, and a base end portion of a wire unit is retained at a second radial position by a wire holder as a second retainer. ... Fujifilm Corporation

05/04/17 / #20170126957

Imaging device, imaging device body, and lens barrel

. . . . . . . . . . . . . . An imaging device includes an apd filter. In a case in which the apd filter is disposed on a light path of an incident ray, an imaging exposure is determined using a corrected diaphragm value (t number) obtained by correcting a diaphragm value on the basis of optical characteristics of the apd filter and an imaging diaphragm, which is determined during the determination of the imaging exposure, is set. ... Fujifilm Corporation

05/04/17 / #20170126948

Imaging device, imaging device body, and lens barrel

An imaging device includes an apd filter. A first program diagram is selected in a case in which the apd filter is not disposed, and a second program diagram is selected in a case in which the apd filter is disposed. ... Fujifilm Corporation

05/04/17 / #20170126930

Image processing device

An image processing device which generates a halftone image includes: an image size adjustment unit which adjusts a size of the input image; and a halftone processing unit which performs halftone processing on the input image size-adjusted to generate a halftone image, wherein: the image size adjustment unit adjusts the input image to a same size in two or more printing modes among the plurality of printing modes, and the input image of the same size is subjected to the halftone processing; the unit limits arrangement of dots constituting the halftone image to dot arrangeable places of a selected printing mode among the plurality of printing modes, and performs the halftone processing based on an error diffusion method using an error diffusion coefficient matrix according to the selected printing mode; and the functions performed by the image size adjustment unit and the halftone processing unit are achieved using a computer.. . ... Fujifilm Corporation

05/04/17 / #20170125330

Anisotropic conductive member and multilayer wiring substrate

An object of the present invention is to provide an anisotropic conductive member capable of achieving excellent conduction reliability and a multilayer wiring substrate using the same. The anisotropic conductive member of the present invention includes an insulating base which is made of an inorganic material, a plurality of conductive paths which are made of a conductive member, penetrate the insulating base in a thickness direction thereof and are provided in a mutually insulated state, and a pressure sensitive adhesive layer which is provided on a surface of the insulating base, in which each of the conductive paths has a protrusion which protrudes from the surface of the insulating base, and an end of the protrusion of each of the conductive paths is exposed or protrudes from the surface of the pressure sensitive adhesive layer.. ... Fujifilm Corporation

05/04/17 / #20170123318

Positive resist composition and method of pattern formation with the same

A positive resist composition comprising: (a) a resin which comes to have an enhanced solubility in an alkaline developing solution by an action of an acid; (b) a compound which generates an acid upon irradiation with actinic rays or a radiation; (c) a fluorine-containing compound containing at least one group selected from the groups (x) to (z); and (f) a solvent, and a method of pattern formation with the composition: (x) an alkali-soluble group; (y) a group which decomposes by an action of an alkaline developing solution to enhance a solubility in an alkaline developing solution; and (z) a group which decomposes by an action of an acid.. . ... Fujifilm Corporation

05/04/17 / #20170123267

Liquid crystal display device

A liquid crystal display device includes a backlight that emits unpolarized blue light, a reflective polarizing layer which is provided on an emission side of the backlight and converts blue light to linearly polarized light, a quantum rod layer which is provided on a blue linearly polarized light emission side of the reflective polarizing layer and converts blue linearly polarized light to red linearly polarized light and green linearly polarized light using multiple quantum rods, and a liquid crystal panel disposed on a red linearly polarized light and green linearly polarized light emission side. In the quantum rod layer, a polarization direction of the blue linearly polarized light emitted from the reflective polarizing layer and a long axis direction of the quantum rods are parallel to each other.. ... Fujifilm Corporation

05/04/17 / #20170121714

Method for producing lipid particles and nucleic acid delivery carrier having lipid particles

An object of the present invention is to provide a method for producing lipid particles which can hold nucleic acids or the like at a high inclusion rate, and a nucleic acid delivery carrier having the lipid particles. According to the present invention, there is provided a method for producing lipid particles including nucleic acids, the method including the following steps of (1) to (4): (1) a step of heating an oil phase containing a phospholipid, an alcohol, and an ester; (2) a step of mixing an oil phase prepared in step (1) with a water phase containing nucleic acids; (3) a step of cooling the mixed liquid which contains the oil phase and the water phase and has been obtained in step (2), and crystallizing lipid particles; and (4) a step of removing the alcohol and the ester from the mixed liquid which contains the oil phase and the water phase and has been obtained in step (3).. ... Fujifilm Corporation

05/04/17 / #20170121441

Polymer, composition, optical film, and liquid crystal display device

A polymer having a partial structure formed by performing radical polymerization with respect to a compound having a mesogenic group derived from at least one type of liquid crystal compound selected from a rod-like liquid crystal compound and a disk-like liquid crystal compound, and two or more polymerizable groups, in which the polymer is a branched polymer, and a composition containing the polymer, an optical film, and a liquid crystal display device.. . ... Fujifilm Corporation

05/04/17 / #20170121437

Pattern forming method, method for manufacturing electronic device, electronic device, active-light-sensitive or radiation-sensitive resin composition, resist film and mask blank

A pattern forming method includes forming a film using an actinic ray-sensitive or radiation-sensitive resin composition, exposing the film with active light or radiation, and developing the exposed film using a developer including an organic solvent, in which the actinic ray-sensitive or radiation-sensitive resin composition contains a compound having a partial structure represented by general formula (i).. . ... Fujifilm Corporation

05/04/17 / #20170121272

Method for producing azido-amine derivative

A method for producing an azido-amine derivative includes obtaining an azido-amine derivative and extracting the azido-amine derivative obtained by using an aromatic solvent or an ether solvent.. . ... Fujifilm Corporation

05/04/17 / #20170120647

Inkjet print device and inkjet head ejection performance evaluation method

An inkjet head ejection performance evaluation method includes: printing a test pattern for examining an ejection condition for each nozzle by an inkjet head and reading the test pattern by an image reading device; measuring a first depositing position for each nozzle from a read image to calculate an angle deviation amount of the inkjet head based on the first depositing position and pattern information; calculating at least one of a second depositing position and second deposit displacement amount in which an influence due to angle deviation caused is eliminated; calculating a moving amount caused by rotation of the angle deviation amount from a reference position of the nozzle at a reference attaching angle up to a current nozzle position; and calculating, by using these calculation results, at least one of a distance between the adjacent pixels and a third deposit displacement amount including the influence.. . ... Fujifilm Corporation

05/04/17 / #20170120600

Wiping mechanism, liquid droplet jetting apparatus, and wiping method

Provided are a wiping mechanism, a liquid droplet jetting apparatus, and a wiping method capable of securing an absorption capacity of a wiping member which absorbs a liquid adhered to a nozzle surface while preventing infiltration of bubbles into a nozzle when the nozzle surface is wiped by the wiping member. The nozzle surface is wiped by the wiping member which has one surface 200a that comes into contact with the nozzle surface in which a plurality of nozzles through which liquid droplets are jetted are formed, and has a plurality of voids m that form capillaries from the one surface 200a side to the other surface 200b side, the voids m being greater in size on the other surface 200b side than on the one surface side 200a among the plurality of voids m.. ... Fujifilm Corporation

05/04/17 / #20170120026

Method of manufacturing sheet

The method includes the steps of: preparing a mold and a liquid filling device; and filling needle-like recessed portions with a liquid medicine by repeating the following: a filling operation in which the liquid medicine is supplied to the mold from the liquid filling device and the needle-like recessed portions are filled with the liquid medicine while a nozzle tip is brought into pressed contact with a surface of the mold; and a moving operation in which a nozzle is relatively moved with respect to the mold while the nozzle tip and the surface of the mold are in contact with each other, wherein the nozzle is held in a z-axis drive unit configured to vertically move the nozzle while an elastic body is provided in the z-axis drive unit, while the nozzle tip is brought into pressed contact with the surface of the mold.. . ... Fujifilm Corporation

05/04/17 / #20170119691

Transdermal absorption sheet, and manufacturing method for the same

A transdermal absorption sheet and a manufacturing method for the transdermal absorption sheet includes a laminating step of forming a multilayer film with a viscosity difference by forming, on a support, a lower layer containing a first transdermal absorption material and an upper layer containing a drug and a second transdermal absorption material and having a lower viscosity than the lower layer, a filling step of filling needle-like recessed portions corresponding to inverted needle-like protruding portions with a solution of the transdermal absorption material by pressing a mold in which the needle-like recessed portions are arranged in a two-dimensional array, against a surface of the multilayer film supported by the support to allow the multilayer film to flow, a solidifying step of solidifying the multilayer film with the mold pressed against the surface of the multilayer film, and a peeling-off step of peeling the solidified multilayer film from the mold.. . ... Fujifilm Corporation

04/27/17 / #20170116717

Radiographic image processing device, radiographic image processing method, and recording medium

. . . . . . . . . . A radiographic image processing device includes: an image acquisition section that acquires a subject image detected by a shielded detection portion and a non-shielded detection portion; an area information acquisition section that acquires area information which is information for specifying a non-shielded image area and a shielded image area; and a scattered ray suppression section that estimates spreading of scattered rays generated in a non-shielded subject portion, estimates that scattered rays that spread to the non-shielded image area from a shielded subject portion are not present, calculates a scattered ray component in each position in the non-shielded image area as the estimated scattered rays reach each position in the non-shielded image area, and suppresses the scattered ray component in each position in the non-shielded image area according to the calculated scattered ray component.. . ... Fujifilm Corporation

04/27/17 / #20170115780

Capacitive touch panel

The present invention provides a capacitive touch panel in which malfunction hardly occurs even when an operation is performed after a finger of an operator touches the capacitive touch panel for a long period of time in an ordinary temperature. The capacitive touch panel according to the invention is a capacitive touch panel comprising: a display device; a lower pressure sensitive adhesive layer; a capacitive touch panel sensor; an upper pressure sensitive adhesive layer; and a protective substrate, in this order, in which temperature dependence of a relative dielectric constant of the upper pressure sensitive adhesive layer which is obtained by a temperature dependency evaluation test described below is 10.0% or less.. ... Fujifilm Corporation

04/27/17 / #20170115778

Method for producing laminated material, laminated material, method for producing transparent laminate, transparent laminate, capacitance-type input device, and image display device

Provided is a method for producing a laminated material, the method including forming a first transparent resin layer on a base material; and forming a second transparent resin layer directly on the first transparent resin layer, in which the forming a first transparent resin layer is applying an organic solvent-based resin composition on the base material, and the forming a second transparent resin layer is applying a water-based resin composition including an ammonium salt of a monomer having an acid group or an ammonium salt of a resin having an acid group. The method for producing a laminated material can provide a laminated material which exhibits satisfactory layer demarcation, and by which a problem caused by moisture absorption of the transparent resin layer formed using a water-based resin composition in a case in which the laminated material is subjected to a high temperature and high humidity environment for a period of time can be suppressed. ... Fujifilm Corporation

04/27/17 / #20170115571

Pattern forming method and method for manufacturing electronic device using same

A pattern forming method includes (a) a step of forming a first resist film on a substrate by using a first resist composition, (b) a step of exposing the first resist film, (c) a step of forming a first pattern by developing the exposed first resist film, (d) a step of forming a planarization layer on the substrate provided with the first pattern by using composition for forming a planarization layer (a), (e) a step of forming a second resist film on the planarization layer by using a second resist composition, (f) a step of exposing the second resist film, and (g) a step of forming a second pattern by developing the exposed second resist film in this order, in which the first pattern is insoluble in the composition for forming the planarization layer (a), and a method for manufacturing an electronic device using the pattern forming method.. . ... Fujifilm Corporation

04/27/17 / #20170115569

Active-light-sensitive or radiation-sensitive resin composition, pattern forming method, and method for manufacturing electronic device

Provided are an active-light-sensitive or radiation-sensitive resin composition having high dof and excellent lwr, a pattern forming method using the composition, and a method for manufacturing an electronic device. The composition is an active-light-sensitive or radiation-sensitive resin composition containing a resin (p), in which the resin (p) includes a repeating unit (a) having a group that decomposes by the action of an acid to generate a polar group, including at least a specific repeating unit (a1) represented by general formula (1); a repeating unit (b1) having at least one of a lactone structure, a sultone structure, or a carbonate structure; and a repeating unit (b2) having at least one of a lactone structure, a sultone structure, or a carbonate structure, which is different from the repeating unit (b1), the ohnishi parameter of the repeating unit (b1) is larger than the ohnishi parameter of the repeating unit (b2), and the difference between both the ohnishi parameters is 0.85 or more.. ... Fujifilm Corporation

04/27/17 / #20170115568

Active-light-sensitive or radiation-sensitive resin composition, pattern forming method, and method for manufacturing electronic device

Provided are an active-light-sensitive or radiation-sensitive resin composition having high depth of focus and excellent resolving power; a pattern forming method using the composition; and a method for manufacturing an electronic device. The composition is an active-light-sensitive or radiation-sensitive resin composition containing a resin (p), in which the resin (p) includes a repeating unit (a) having an acid-decomposable group and a repeating unit (b) having a lactone structure and the like; the repeating unit (a) includes at least a specific repeating unit (a1) represented by general formula (1); the content of the repeating units (a1) with respect to all the repeating units of the resin (p) is 35% by mole or more; and the resin (p) does not include any of a specific group represented by general formula (x1), a specific structure represented by general formula (x2), a hydroxyadamantyl group, and a hydroxyadamantyl group in which a hydroxy group is protected with a group that decomposes by the action of an acid to leave.. ... Fujifilm Corporation

04/27/17 / #20170115528

Liquid crystal panel, liquid crystal display device, and reflective polarizing plate and manufacturing method thereof

An aspect of the present invention relates to a liquid crystal panel including a visible side polarizing plate, a liquid crystal cell, and a backlight side polarizing plate, in which the backlight side polarizing plate is a reflective polarizing plate of which a degree of polarization p550 nm with respect to light at a wavelength of 550 nm is greater than or equal to 99.90%, and the reflective polarizing plate and the liquid crystal cell are integrally laminated, a liquid crystal display device, and a reflective polarizing plate and a manufacturing method thereof.. . ... Fujifilm Corporation

04/27/17 / #20170115208

Sensing system and sensing method

The invention provides a method of sensing a target object due to a change in light intensity detected when the target object passes to cross a light path of circularly polarized light, in a state where circularly polarized light selectively including any one sense of right circularly polarized light and left circularly polarized light is sensed, and a system including: an emission unit which emits circularly polarized light; a target object movement unit; and a detection unit which senses circularly polarized light, in this order, in which the detection unit is at a position where light emitted from the emission unit is incident, a light path of light where the light emitted from the emission unit is incident to the detection unit intersects with the target object movement unit, and the sense of circularly polarized light selectively emitted by the emission unit and the sense of circularly polarized light selectively sensed by the detection unit are the same as each other. It is possible to sense various target objects by using an optical sensor with excellent sensitivity and decreased erroneous sensing in an arbitrary environment, by using the method and the system of the invention.. ... Fujifilm Corporation

04/27/17 / #20170113470

Liquid discharge apparatus and method of conveying medium

A liquid discharge apparatus includes: a liquid discharge head; a conveyer that supports and conveys a medium; a blower that is disposed on the upstream side of the liquid discharge head or the downstream side of the liquid discharge head and suppresses the change of the posture of the medium by sending the air to the medium; a temperature adjuster that is disposed on the side of the blower opposite to the liquid discharge head in the medium conveying direction and adjusts the temperature of an object to a temperature higher than the ambient temperature of the liquid discharge head or a temperature lower than the ambient temperature of the liquid discharge head; and a blast controller sends an operation stop command or an air reduction command to the blower at a blast region-pass timing at which the medium passes through a blast region of the blower.. . ... Fujifilm Corporation

04/27/17 / #20170113263

Plastic deformation method of tightly wound coil spring

A plastic deformation method of a tightly wound coil spring includes a regulating process and a plastic deformation process. In the regulating process, a tightly wound coil spring is inserted into a pipe, and deformation of the tightly wound coil spring in a tightly wound coil spring radial direction is regulated by the pipe. ... Fujifilm Corporation

04/27/17 / #20170112937

Method for producing aqueous ophthalmic composition, and aqueous ophthalmic composition

A method of producing an aqueous ophthalmic composition includes wet grinding a mixture that includes a carbonic anhydrase inhibitor, a cellulose derivative, and water, in which a 2%-by-mass aqueous solution of the cellulose derivative has a viscosity of 60 mpa·s or less at 20° c. An aqueous ophthalmic composition includes a carbonic anhydrase inhibitor, a cellulose derivative, and water, in which an absorbance of the aqueous ophthalmic composition at a wavelength of 600 nm and an optical path length of 1 mm is 1.1 or less and a 2%-by-mass aqueous solution of the cellulose derivative has a viscosity of 60 mpa·s or less at 20° c.. ... Fujifilm Corporation

04/27/17 / #20170112934

Aqueous ophthalmic composition

An aqueous ophthalmic composition includes a carbonic anhydrase inhibitor; at least one cellulose derivative selected from the group consisting of hydroxypropylmethyl cellulose acetate succinate and carboxymethylethyl cellulose; and water.. . ... Fujifilm Corporation

04/27/17 / #20170112386

Photoacoustic image generation apparatus and insert

An insert includes: an insert body that has an opening and has an inner cavity therein; a light guide member that is inserted into the inner cavity of the insert body and guides light emitted from a light source; a light emitting portion that emits light guided by the light guide member; a light absorption member that generates photoacoustic waves by absorbing the light emitted from the light emitting portion; and a proximal end portion that has an inlet of liquid and a chamber communicating with the inlet and the inner cavity of the insert body. The inner cavity has a space for flow of the liquid, and liquid injected through the inlet is capable of flowing from the opening of the insert body through the chamber and the space for flow of the liquid.. ... Fujifilm Corporation

04/27/17 / #20170112363

Endoscope

An elevator provided in a treatment tool leading section of a leading end section of the endoscope includes a wide body portion that is provided on a distal end side with respect to a rotation shaft, and has a width more than that of a narrow body portion provided on a proximal end side. The wide body portion projects through an opening in an upper portion in an elevator accommodation groove in a state where the elevator rises most. ... Fujifilm Corporation

04/27/17 / #20170112362

Endoscope

An elevator assembly to be accommodated in the leading end section of the endoscope includes an assembly body, an elevator, and an elevation lever. The elevator includes an elevator rotation shaft portion, the elevation lever includes a lever rotation shaft portion, and the assembly body includes a bearing hole for supporting the rotation shaft portions and. ... Fujifilm Corporation

04/20/17 / #20170111746

Electro-acoustic conversion film and digital speaker

. . Provided is an electro-acoustic conversion film that is suitably used for a digital speaker or the like, and that includes a polymer composite piezoelectric body formed by dispersing piezoelectric particles in a viscoelastic matrix formed of a polymer material having viscoelasticity at room temperature, and thin-film electrodes provided on both surfaces of the polymer composite piezoelectric body, and at least one of the thin-film electrodes is divided into a plurality of regions of which an area increases by 2n times (n is a natural number including 0). Thus, a digital speaker in which reverberation or crosstalk between segments is suppressed is obtained.. ... Fujifilm Corporation

04/20/17 / #20170111745

Electro-acoustic conversion film and digital speaker

Provided is an electro-acoustic conversion film that is suitably used for a digital speaker or the like, and that includes a polymer composite piezoelectric body formed by dispersing piezoelectric particles in a viscoelastic matrix formed of a polymer material having viscoelasticity at room temperature, and thin-film electrodes provided on both surfaces of the polymer composite piezoelectric body, in which at least one of the thin-film electrodes is divided into a plurality of regions having the same area, and the respective regions are coupled in parallel and grouped to correspond to a weight of each bit digit of a parallel pcm digital signal. Thus, an electro-acoustic conversion film by which a digital speaker in which reverberation or crosstalk between segments is suppressed is obtained is provided.. ... Fujifilm Corporation

04/20/17 / #20170110762

Manufacturing method for amino-substituted phosphazene compound, manufacturing method for electrolyte solution for nonaqueous secondary battery, and manufacturing method for nonaqueous secondary battery

Provided is a manufacturing method for an amino-substituted phosphazene compound, including: reacting a fluorinated phosphazene compound and an amine compound in presence of a catalyst consisting of a compound consisting of a specific element m below and an oxygen atom as constituent elements; and obtaining an amino-substituted phosphazene compound by substitution reaction between a fluorine atom of the fluorinated phosphazene compound and an amino group of the amine compound. Specific element m: at least one selected from magnesium, titanium, zirconium, vanadium, lithium, calcium, aluminum, manganese, molybdenum, silicon, or boron.. ... Fujifilm Corporation

04/20/17 / #20170110758

Manufacturing method for amino-substituted phosphazene compound, manufacturing method for electrolyte solution for nonaqueous secondary battery, and manufacturing method for nonaqueous secondary battery

Provided are a manufacturing method for an amino-substituted phosphazene compound including reacting a fluorinated phosphazene compound and an amine compound in presence of a compound having a fluorine trapping function; and synthesizing a compound obtained by substituting the amine compound for the fluorinated phosphazene compound, a manufacturing method for an electrolyte solution for a nonaqueous secondary battery using this, and a manufacturing method for a nonaqueous secondary battery.. . ... Fujifilm Corporation

04/20/17 / #20170109934

Augmented reality providing system and method, information processing device, and program

An augmented reality providing system and method, an information processing device, and a non-transitory computer readable recording medium recorded with a program are provided. An augmented reality providing system includes a unit for acquiring three-dimensional data, a unit for generating three-dimensional shaping data of a first model from the three-dimensional data, a unit for shaping and outputting a shaped object on the basis of the three-dimensional shaping data, imaging a unit for imaging the shaped object, a unit for calculating a camera parameter from the captured image, a unit for generating a second model including a region of interest that is a non-shaping target from the three-dimensional data, and a unit for determining a depth relationship between the shaped object and the second three-dimensional model on the basis of the camera parameter, and a virtual object of the region of interest in front of the shaped object is displayed.. ... Fujifilm Corporation

04/20/17 / #20170108726

Liquid crystal display device

Provided is a liquid crystal display device in which color reproducibility and brightness are improved. The liquid crystal display device includes a backlight that emits unpolarized blue light, a quantum rod layer which is provided on an emission side of the backlight and converts some of blue light to red linearly polarized light and green linearly polarized light using multiple quantum rods, a reflective polarizing layer which is provided on a side from which the red linearly polarized light and the green linearly polarized light of the quantum rod layer are emitted, and a liquid crystal panel disposed on a blue linearly polarized light emission side of the reflective polarizing layer, and a long axis direction of the quantum rods in the quantum rod layer and a polarization direction of the blue linearly polarized light emitted from the reflective polarizing layer are parallel to each other.. ... Fujifilm Corporation

04/20/17 / #20170108692

Endoscope

An endoscope includes an image sensor that is provided at a front end portion of an insertion portion of the endoscope so that an image receiving surface of the image sensor is disposed to cross a longitudinal axis of the insertion portion; a sensor holder that surrounds an outer circumference of the image sensor and holds the image sensor; and a circuit board including a sensor connection portion and an electric wire connection portion as defined herein; the image sensor is held by the sensor holder as defined herein; the sensor connection portion and the electric wire connection portion are connected to each other as defined herein; and an outside edge of a connection site between the sensor connection portion and the electric wire connection portion is located as defined herein.. . ... Fujifilm Corporation

04/20/17 / #20170108691

Endoscope

An endoscope includes an image sensor that is disposed at a front end portion of an insertion portion of the endoscope; a circuit board that is mounted with the image sensor; a plurality of electric wires that are electrically connected to the circuit board; and a retention member that has a retention portion tying up the electric wires; and the retention portion is disposed in a narrowed section that is provided in the insertion portion and inside a part adjacent to the front end portion in an axial direction of the insertion portion and narrowed in a narrowing direction perpendicular to the axial direction so that the electric wires are tied up to be longer in a direction perpendicular to the narrowing direction and the axial direction than in the narrowing direction.. . ... Fujifilm Corporation

04/20/17 / #20170106637

Optical film, polarizing plate, and image display device

An aspect of the invention relates to an optical film including a cellulose acylate film; and a hardened layer formed by hardening a curable composition, in which the cellulose acylate film includes polyester having a cyclic structure, the curable composition at least includes a granular filler, a polyester urethane having a tensile strength of 25 mpa or greater and a tensile elongation of 200% or greater, and a curable compound, and a content of the granular filler is in a range of 15 to 60 parts by mass and a content of the polyester urethane is in a range of 1 to 10 parts by mass, with respect to 100 parts by mass of a total amount of a solid content included in the curable composition, a polarizing plate, and an image display device.. . ... Fujifilm Corporation

04/20/17 / #20170105626

Optical fiber cable, method of manufacturing the same, and light source module including the same

A plug that is engaged with a receptacle for light emission of a light source unit that emits a light beam having a flat-shaped cross section and an optical fiber having a burr defect in a part of an outer peripheral portion of an incidence end surface on which the light beam is incident are included. The plug is attached to an incidence end portion of the optical fiber in an arrangement in which the burr defect is located in a short axis direction of a cross section on the incidence end surface of the light beam incident on the incidence end surface in a state in which the plug is engaged with the receptacle.. ... Fujifilm Corporation

04/13/17 / #20170104929

Imaging device

. . . . An imaging device according to an aspect of the invention includes an imaging optical system (12) having a wide-angle optical system and a telephoto optical system which are provided in different regions, a directional sensor (17) that has a plurality of pixels including photoelectric conversion elements which are two-dimensionally arranged, pupil-divides light beams which are incident through the wide-angle optical system and the telephoto optical system, and selectively receives the beams, a pan/tilt mechanism (32) that moves a direction of an imaging optical axis of the telephoto optical system with respect to a direction of an imaging optical axis of the wide-angle optical system, and an image acquisition unit (22) that acquires a wide-angle image received from the directional sensor (17) through the wide-angle optical system and a telephoto image received from the directional sensor (17) through the telephoto optical system.. . ... Fujifilm Corporation

04/13/17 / #20170104923

Imaging apparatus with display and image display apparatus

A digital camera is provided with a vertically long camera body having an approximately rectangular solid shape. An lcd panel provided in a rear surface of the camera body is arranged such that longitudinal directions of the display screen and the camera body correspond to each other. ... Fujifilm Corporation

04/13/17 / #20170104177

Organic electronic device sealing member

The present invention provides an organic electronic device sealing member including a gas barrier film including an inorganic layer and an organic layer and an adhesive layer, in which the adhesive layer includes a polymerizable compound and an organic metal compound, an average secondary particle diameter of the organic metal compound is 100 nm or less, and the organic metal compound has a structure represented by formula i: -[m(or)—o]n-. In formula i, m represents a trivalent metal atom, r represents a substituted or unsubstituted alkyl group, a substituted or unsubstituted aryl group, or a substituted or unsubstituted alkylcarbonyl group, n represents an integer of 2 to 6, two or more r's may be the same as or different from each other, and a first [m(or)—o] and an n-th [m(or)—o] are bonded to each other. ... Fujifilm Corporation

04/13/17 / #20170103436

Coordination server, coordination system, and coordination method

An object of the present invention is to provide a coordination server, a coordination system, and a coordination method capable of reflecting an intention of a providing source of a first product in search for a second product to be combined with the first product. In a preferred aspect of the present invention, a coordination server (10) is a coordination server (10) that performs coordination of a second product for a first product, and includes a coordination condition acquisition unit (25) that acquires a coordination condition that is information on a product that is combinable with the first product, which is set by a providing source of the first product, and a product group generation unit (27) that generates a first product group consisting of candidate products of the second product on the basis of the coordination conditions.. ... Fujifilm Corporation

04/13/17 / #20170103405

Statistical data generation server device, statistical data generation system, and statistical data generation method

A statistical data generation server device includes a server reception unit, an accumulation unit that accumulates an operation history of products corresponding to a user operation received by the server reception unit, a population generation unit that generates a population for generating statistical data, the population being a population consisting of the products, on the basis of the operation history accumulated in the accumulation unit, a design feature amount acquisition unit that acquires a design feature amount obtained by analyzing an image of the product for each product included in the population generated by the population generation unit, and a statistical data generation unit that generates statistical data obtained by classifying the products on the basis of the design feature amount acquired for each product, the statistical data being statistical data indicating a frequency distribution obtained by classifying the products according to the design feature amount.. . ... Fujifilm Corporation

04/13/17 / #20170102618

Method of forming pattern

Provided is a method of forming pattern including (a) forming a chemically amplified resist composition into a film, (b) exposing the film to light, and (c) developing the exposed film with a developer containing a first organic solvent, wherein in the developer, particles each having a diameter of 0.3 μm or greater amount to a density of 30 particles/ml or less.. . ... Fujifilm Corporation

04/13/17 / #20170102490

Light conversion film, method for manufacturing same, laminate, and method for manufacturing same

The present invention provides a light conversion film capable of suppressing a decrease in light emission efficiency even when the film is continuously irradiated with light and suppressing a change in degree of polarization even under a wet heat environment, a method for manufacturing the same, a laminate, and a method for manufacturing the same. The light conversion film of the present invention includes a polymer, and quantum rods, in which the quantum rods are aligned such that a major axis of each of the quantum rods is parallel to one direction parallel to a surface of the light conversion film, a moisture content is 1.0% or less, and an oxygen permeability coefficient is 200 cc·20 μm/m2·day·atm or less.. ... Fujifilm Corporation

04/13/17 / #20170102483

Near infrared ray absorbent composition, near infrared ray cut filter, manufacturing method of near infrared ray cut filter, solid image pickup element, camera module

Provided are a near infrared ray absorbent composition which can form a cured film having excellent heat resistance while maintaining high near infrared ray shielding properties, and a near infrared ray cut filter, a manufacturing method of a near infrared ray cut filter, a solid image pickup element, and a camera module using the near infrared ray absorbent composition. The near infrared ray absorbent composition contains a compound having a partial structure represented by m-x, and a near infrared ray absorbent compound, and a content of the compound having a partial structure represented by m-x is greater than or equal to 15 mass % with respect to a total solid content of the near infrared ray absorbent composition. ... Fujifilm Corporation

04/13/17 / #20170102342

Conductive film, display device having the same, and method of evaluating conductive film

In a conductive film, a method of evaluating a pattern in the conductive film, and a display device, thin metal lines of at least one wiring portion of two wiring portions is formed in a wiring pattern where the opening portions, of which angles are maintained and pitches are made to be irregular with respect to rhomboid shapes of a regular rhomboid wiring pattern, have parallelogram shapes. In frequencies of the moirés that are equal to or less than a frequency threshold value and are calculated for each color from two peak frequencies and two peak intensities of 2dfft spectra of image data of the wiring patterns of the two wiring portions and luminance image data of pixel array patterns of the respective colors at the time of lighting up for each single color, the wiring patterns of the two wiring portions are formed such that an indicator of evaluation of moirés is equal to or less than an evaluation threshold value. ... Fujifilm Corporation

04/13/17 / #20170101608

Cleaning formulation for removing residues on surfaces

This disclosure relates to a cleaning composition that contains 1) at least one redox agent; 2) at least one first chelating agent, the first chelating agent being a polyaminopolycarboxylic acid; 3) at least one second chelating agent different from the first chelating agent, the second chelating agent containing at least two nitrogen-containing groups; 4) at least one metal corrosion inhibitor, the metal corrosion inhibitor being a substituted or unsubstituted benzotriazole; 5) at least one organic solvent selected from the group consisting of water soluble alcohols, water soluble ketones, water soluble esters, and water soluble ethers; 6) water; and 7) optionally, at least one ph adjusting agent, the ph adjusting agent being a base free of a metal ion. This disclosure also relates to a method of using the above composition for cleaning a semiconductor substrate.. ... Fujifilm Corporation

04/13/17 / #20170101534

Coloring composition for dyeing or textile printing, ink for ink jet textile printing, method of printing on fabric, and dyed or printed fabric

Provided are a coloring composition for dyeing or textile printing including a compound having the following structure, an ink for ink jet textile printing including the above-described coloring composition for dyeing or textile printing, a method of printing on fabric, and a dyed or printed fabric. As a result, the color is excellent, the color optical density is high, the fixing properties are excellent, bleeding is reduced, and light fastness is excellent.. ... Fujifilm Corporation

04/13/17 / #20170101533

Novel compound, coloring composition for dyeing or textile printing, ink jet ink, method of printing on fabric, and dyed or printed fabric

Provided are a compound represented by any one of formulae (1) to (3) (for example, the following compound), a coloring composition for dyeing or textile printing including the compound, an ink jet ink including the coloring composition for dyeing or textile printing, a method of printing on fabric, and a dyed or printed fabric, in which the color is excellent, the color optical density is high, and light fastness, water fastness, and chlorine fastness are excellent.. . ... Fujifilm Corporation

04/13/17 / #20170100926

Method of manufacturing electronic device and composite film

Provided is a method of manufacturing an electronic device including: drying a pressure sensitive adhesive layer of a composite film which has the pressure sensitive adhesive layer; and a first film and a second film bonded to each surface of the pressure sensitive adhesive layer and in which a moisture vapor transmission rate of the first film at a temperature of 40° c. And a relative humidity of 90% is 100 g/(m2·day) or greater; peeling the first film from the composite film in which the pressure sensitive adhesive layer is dried; and bonding the composite film from which the first film is peeled to an electronic device. ... Fujifilm Corporation

04/13/17 / #20170100519

Cell structure and method for producing cell structure

An object of the present invention is to provide a cell structure which does not contain glutaraldehyde and can form blood vessels after transplantation, and a method for producing the above-described cell structure. According to the present invention, there is provided a cell structure which contains a biocompatible macromolecular block and at least one kind of cell and has voids and in which a plurality of the biocompatible macromolecular blocks are arranged in gaps between a plurality of the cells, in which a ratio of the volume of the biocompatible macromolecular blocks with respect to the volume of the cell structure is 10% to 30%, a ratio of the volume of the cells with respect to the volume of the cell structure is 20% to 50%, and a ratio of the volume of the voids with respect to the volume of the cell structure is 35% to 60%.. ... Fujifilm Corporation

04/13/17 / #20170100093

Acoustic wave image generating apparatus and control method thereof

There are provided an acoustic wave image generating apparatus for generating a b-mode image having a fixed brightness and a control method thereof. First brightness information (81) indicating the brightness of a first b-mode image in the depth direction of the subject is generated. ... Fujifilm Corporation

04/13/17 / #20170100041

Photoacoustic measurement apparatus and probe for photoacoustic measurement

A probe has a light guide unit that guides the measurement light, an acoustic wave detection unit that detects a photoacoustic wave, and a storage unit that stores light intensity profile information that represents the light intensity profile of the measurement light emitted by the probe, and transmits a signal of the photoacoustic wave detected by the acoustic wave detection unit to the signal processing unit in a state in which the probe is mounted in the apparatus body. The apparatus body has a reading unit that reads the light intensity profile information from the storage unit, and the intensity adjusting unit adjusts the intensity of the measurement light employing the light intensity profile information read by the reading unit.. ... Fujifilm Corporation

04/06/17 / #20170099436

Imaging device

. . . . In a preferred aspect of the invention, an imaging optical system having a wide-angle optical system and a telephoto optical system which are provided in different regions is provided. A directional sensor that has a plurality of pixels including photoelectric conversion elements which are two-dimensionally arranged pupil-divides light beams which are incident through the wide-angle optical system and the telephoto optical system, and selectively receives the light beams. ... Fujifilm Corporation

04/06/17 / #20170098322

Image display device and image display method

An image display device according to a preferred aspect of the present invention includes a display controller controlling display of an image in a display unit. The display controller simultaneously displays a first image and a second image on the display unit, allows a position of a display target image of the first image in the display unit to be coincident with a position of a display target image of the second image in the display unit, and sets a first image display region in which the first image is displayed is narrower than a second image display region in which the second image is displayed in the display unit.. ... Fujifilm Corporation

04/06/17 / #20170097544

Optical film, polarizing plate and liquid crystal display device

There is provided an optical film including an acrylic resin, wherein a tensile elastic modulus in a machine direction, which is abbreviated as an md direction, and a tensile elastic modulus in a direction perpendicular to the machine direction, which is abbreviated as a td direction, satisfy the relationship of equation (1): equation (1) tensile elastic modulus in the md direction/tensile elastic modulus in the td direction>1.36.. . ... Fujifilm Corporation

04/06/17 / #20170095999

Transfer film, method for manufacturing transfer film, laminate, method for manufacturing laminate, capacitive input device, and image display device

A transfer film according to a first embodiment has a temporary support and a first transparent resin layer containing a metal oxidation inhibitor, in which the first transparent resin layer has a refractive index of 1.60 or higher. A transfer film according to a second embodiment has a temporary support and a first transparent resin layer, in which the first transparent resin layer contains a metal oxidation inhibitor and metal oxide particles.. ... Fujifilm Corporation

04/06/17 / #20170095947

Method of manufacturing mold and method of manufacturing pattern sheet

There is provided a method capable of manufacturing a mold at low cost, and a method of manufacturing a biocompatible pattern sheet by using the mold. The method of manufacturing a mold having a recessed pattern includes the steps of: forming a silicone resin film by applying a silicone resin solution to a surface of a model having a protrusion pattern; defoaming the silicone resin film by reducing the silicone resin film in pressure; forming the mold by heating and curing the silicone resin film while a base plate is in contact with a face of the silicone resin film, the face being opposite to the model; and releasing the mold from the model after releasing the base plate. ... Fujifilm Corporation

04/06/17 / #20170095946

Method of manufacturing mold and method of manufacturing pattern sheet

The method of manufacturing a mold includes the steps of: forming a silicone resin film on a surface of a model having a protrusion pattern; pressing a side of a base plate with which a separation sheet is in close contacts on a gap adjustment mechanism and the silicone resin film; heating and curing the silicone resin film to form the mold; releasing the base plate; and releasing the separation sheet from the mold, after releasing the mold from the model, wherein the gap adjustment mechanism has a height at which a tip of the protrusion pattern sticks into the separation sheet when the base plate is pressed on the gap adjustment mechanism. The method of manufacturing a pattern sheet uses the mold.. ... Fujifilm Corporation

04/06/17 / #20170095595

Cell structure for brain damage treatment, production method thereof, and brain damage treatment agent

An object of the present invention is to provide a cell structure for brain damage treatment which does not contain glutaraldehyde and in which it is possible to exhibit a sufficient effect of treating brain damage, a production method thereof, and a brain damage treatment agent. According to the present invention, there is provided a cell structure for brain damage treatment which contains biocompatible macromolecular blocks and at least one kind of cell and in which a plurality of the biocompatible macromolecular blocks are disposed in gaps between a plurality of the cells, in which the tap density of the biocompatible macromolecular block is 10 mg/cm3 to 500 mg/cm3 or a value obtained by dividing a square root of a cross-sectional area in a two-dimensional cross-sectional image of the biocompatible macromolecular block by a peripheral length is 0.01 to 0.13.. ... Fujifilm Corporation

04/06/17 / #20170095427

Transdermal absorption sheet and method of manufacturing transdermal absorption sheet

Provided are a transdermal absorption sheet capable of suppressing a sheet portion from being curled and of improving impact resistance of the sheet portion, and a method of manufacturing the transdermal absorption sheet, capable of suppressing a sheet portion from being curled in drying and of shortening a time required for drying a base material liquid. A transdermal absorption sheet includes: a sheet portion; a plurality of needle-like protruding portions that are arranged on one surface of the sheet portion; and a sheet-like mesh structure body that is included in the sheet portion and that has an area, in a plan view, including at least a part of a region in which the plurality of needle-like protruding portions are arranged.. ... Fujifilm Corporation

04/06/17 / #20170095229

Hand-held medical imaging system with improved user interface for deploying on-screen graphical tools and associated apparatuses and methods

A portable ultrasound system having an enhanced user interface is disclosed herein. In one embodiment, a portable ultrasound system can include a hand-held base unit configured to present a graphical user interface that contains a first control area, a second control area, and an active image area. ... Fujifilm Corporation

04/06/17 / #20170095220

Integrated multi-rail imaging system

The imaging system can comprise a plurality of elongated rails, a scanhead assembly, and a small animal mount assembly. The scanhead assembly is selectively mounted onto a first rail and is constructed and arranged for movement in a linear bi-directional manner along the longitudinal axis of the first rail. ... Fujifilm Corporation

03/30/17 / #20170094267

Stereoscopic image reproduction device and method, stereoscopic image capturing device, and stereoscopic display device

. . . . . . . . A stereoscopic image is displayed with an appropriate amount of parallax on the basis of auxiliary information recorded in a three-dimensional image file. A 2d image file is read (step s31), and the size of a display which performs 2d display is acquired (step s32). ... Fujifilm Corporation

03/30/17 / #20170094241

Image processing device, imaging device, image processing method, and image processing program

An image processing device includes a first image acquisition unit that acquires each of a first imaging signal indicating a flash emission image and a second imaging signal indicating a flash non-emission image, a second image acquisition unit that acquires a third imaging signal indicating a difference between the first imaging signal and the second imaging signal that have been acquired, a third image acquisition unit that acquires a fourth imaging signal obtained by multiplying the acquired third imaging signal by a white balance gain for a flash for removing an influence due to color of the flash light, a color signal acquisition unit that acquires a color signal indicating a first color of each area in an imaging screen on the basis of the acquired fourth imaging signal, and a first white balance gain calculation unit.. . ... Fujifilm Corporation

03/30/17 / #20170094240

Image processing device, imaging device, image processing method, and program

A flash image component acquisition unit (40) of an image processing device (31) acquires the flash image component data on the basis of first image data which is acquired by capturing an image of the object while flash light is emitted. A flash correction data acquisition unit (42) acquires flash correction data in which the difference in the luminosity of the flash image component data caused by the color of the object has been reflected. ... Fujifilm Corporation

03/30/17 / #20170092316

Metal oxide particle dispersion for manufacturing particulate magnetic recording medium, method of manufacturing magnetic layer-forming composition of particulate magnetic recording medium and method of manufacturing particulate magnetic recording medium

The metal oxide particle dispersion for manufacturing a particulate magnetic recording medium contains metal oxide particles, solvent, and a polyester compound having one or more groups selected from the group consisting of a carboxyl group and a salt thereof, a phosphoric acid group and a salt thereof, a hydroxyl group and a nitrogen-substituted alkylene group, but substantially not containing ferromagnetic powder.. . ... Fujifilm Corporation

03/30/17 / #20170092315

Magnetic tape and method of manufacturing the same

The magnetic tape has a magnetic layer containing ferromagnetic powder and binder on a nonmagnetic support, wherein the magnetic layer contains a fatty acid ester, the full width at half maximum of the spacing distribution as measured by optical interferometry on the magnetic layer side surface of the magnetic tape before vacuum heating the magnetic tape is greater than 0 nm but less than or equal to 5.0 nm, the full width at half maximum of the spacing distribution after vacuum heating the magnetic tape is greater than 0 nm but less than or equal to 5.0 nm, and the difference between the spacing safter after vacuum heating the magnetic tape and the spacing sbefore before vacuum heating the magnetic tape, safter−sbefore, is greater than 0 nm but less than or equal to 8.0 nm.. . ... Fujifilm Corporation

03/30/17 / #20170092314

Magnetic recording medium, magnetic signal reproduction device and method of manufacturing magnetic recording medium

The magnetic recording medium has a magnetic layer containing multiple nonmagnetic particles having a ratio, major axis length/minor axis length, of less than or equal to 1.5, the multiple nonmagnetic particles are present in the magnetic layer in a state where, when the depth to which each of the multiple nonmagnetic particles is embedded in the magnetic layer in observation of a sectional image picked up by sem is denoted as b and the thickness of the magnetic layer as t, the average value of the ratio of b/t is less than or equal to 0.9, and the number of protrusions 5 nm or greater in height is 800 or greater and the number of protrusions 20 nm or greater in height is 20 or less as measured by afm per an area 40 μm×40 μm on the magnetic layer side surface of the magnetic recording medium.. . ... Fujifilm Corporation

03/30/17 / #20170092005

Three-dimensional shaping system, and information processing device and method

A three-dimensional shaping system (10) includes a device (20) which acquires three-dimensional data, a device (22) which generates shaping target object data from the three-dimensional data, a device (26) which generates three-dimensional shaping data by adding, to the shaping target object data, attachment part data representing a three-dimensional shape of a marker attachment part (42) for attaching a marker (50) to a shaped object (40) shaped based on the shaping target object data, a device (14) which shapes and outputs the shaped object on the basis of the three-dimensional shaping data, an imaging device (60) which images the shaped object (40) in a state of the marker (50) being attached, and a device (76) which recognizes the marker from a captured image to calculate a camera parameter.. . ... Fujifilm Corporation

03/30/17 / #20170091919

Image registration device, method, and program

There is provided an image registration device, method, and program capable of performing registration between two images obtained by imaging a subject configured to include parts of a plurality of bones, such as the vertebral column, with high accuracy. The image registration device includes: a medical image acquisition unit that acquires first and second three-dimensional images by imaging a subject configured to include parts of a plurality of bones at different points in time; an identification unit that identifies the parts of the plurality of bones included in each of the first and second three-dimensional images; a matching unit that matches a part of each bone included in the first three-dimensional image with a part of each bone included in the second three-dimensional image; and a registration processing unit that performs registration processing between images of the matched parts of the bones.. ... Fujifilm Corporation

03/30/17 / #20170091594

Subject evaluation system, subject evaluation method and recording medium storing subject evaluation program

A principal-subordinate relationship between two subjects is decided with regard to multiple subjects included in an image. Similarly, with regard also to other images, a principal-subordinate relationship between two subjects is decided with regard to multiple subjects included in each image. ... Fujifilm Corporation

03/30/17 / #20170091554

Image alignment device, method, and program

There is provided an image registration device, method, and program that enable easy initial registration between a target object included in a video and a simulation image. A first registration unit performs first registration that is initial registration between an intraoperative video and a simulation image. ... Fujifilm Corporation

03/30/17 / #20170091552

Image evaluation system, image evaluation method and recording medium storing image evaluation program

Provided are an image evaluation system, as well as an image evaluation method, and recording medium storing an image evaluation program, in which when an image is selected from among multiple images, images are evaluated in such a manner that an image such as a scenic image or still-life image will be selected with little image bias. To achieve this, an individual image composition/subject matrix is found, the matrix comprising types of composition and types of subject included in an image. ... Fujifilm Corporation

03/30/17 / #20170090248

Manufacturing method of quantum dot-containing laminated body, quantum dot-containing laminated body, backlight unit, liquid crystal display device, and quantum dot-containing composition

Provided is manufacturing method of a quantum dot-containing laminated body including: forming a coating film by applying a quantum dot-containing composition which contains quantum dots, a curable compound, and a thixotropic agent and has a viscosity in a case of a shear rate of 500 s−1 of 3 to 100 mpa·s and a viscosity in a case of a shear rate of 1 s−1 of equal to or greater than 300 mpa·s, onto a first base material; laminating a second base material onto the coating film; and applying external stimuli to the coating film sandwiched between the first base material and the second base material for hardening, and forming a quantum dot-containing layer. The manufacturing method realizes high productivity, obtains a quantum dot-containing layer without coating streaks, and has slight film thickness unevenness of the quantum dot-containing laminated body.. ... Fujifilm Corporation

03/30/17 / #20170090193

Head-up display

Disclosed is a head-up display capable of achieving reduction in size while securing an optical path length from an image display element to an image reflecting surface. In a head-up display, a reflection optical system has at least three or more mirrors including an l-th mirror, an m-th mirror, and an n-th mirror sequentially in this order from the image display element side along a light beam emitted from the image display element d, the n-th mirror has a refractive power and is arranged closest to the image reflecting surface side among all mirrors, the light beam emitted from the image display element d is reflected from the l-th mirror, the m-th mirror, and the n-th mirror in this order, the light beam emitted from the n-th mirror passes between the l-th mirror and the m-th mirror and reaches the image reflecting surface, and predetermined conditional expressions are further satisfied.. ... Fujifilm Corporation

03/30/17 / #20170090192

Imaging lens and imaging apparatus including the imaging lens

An imaging lens consists of three lenses of, in order from an object side, a first lens having a biconcave shape, and an object-side surface of which is aspherical, a second lens having negative refractive power and a third lens having positive refractive power with a convex surface facing an image side. The absolute value of a curvature radius of an image-side surface of the third lens is less than the absolute value of a curvature radius of an object-side surface of the third lens.. ... Fujifilm Corporation

03/30/17 / #20170090170

Zoom lens and imaging apparatus

A zoom lens is constituted by, in order from the object side: a positive first lens group; a negative second lens group; a positive third lens group; a positive fourth lens group; a negative fifth lens group, and a positive sixth lens group. The distances among adjacent lens groups change when changing magnification from the wide angle end to the telephoto end. ... Fujifilm Corporation

03/30/17 / #20170090169

Zoom lens and imaging apparatus

A zoom lens is constituted by, in order from the object side: a positive first lens group; a negative second lens group; a positive third lens group; a positive fourth lens group; a negative fifth lens group, and a positive sixth lens group. The distances among adjacent lens groups change when changing magnification from the wide angle end to the telephoto end. ... Fujifilm Corporation

03/30/17 / #20170090163

Rear convertor lens and imaging apparatus

A rear converter lens consists of three lens groups of, in order from its object-side, a first lens-group having positive refractive power; a second lens-group having negative refractive power; and a third lens-group having positive refractive power. The first lens-group consists of a cemented lens of a negative lens having a concave surface facing an image-side of the rear converter lens and a positive lens cemented together in order from the object-side. ... Fujifilm Corporation

03/30/17 / #20170090151

Imaging lens and imaging apparatus

An imaging lens includes, in order from the object side, a first lens group fixed during focusing, a positive second lens group moved toward the object side during focusing from a distant to a close object, and a third lens group fixed during focusing and including one positive lens. The second group includes, in order from the object side, a first cemented lens including a biconvex lens and a negative lens having a smaller absolute value of curvature radius of the object-side surface than of the image-side surface, and a second cemented lens having a positive refractive power and including a negative lens having a smaller absolute value of curvature radius of the image-side surface than of the object-side surface and a positive lens having a smaller absolute value of curvature radius of the object-side surface than of the image-side surface. ... Fujifilm Corporation

03/30/17 / #20170090150

Imaging lens and imaging apparatus

An imaging lens consists of, in order from the object side, a first lens group fixed during focusing, and a positive second lens group moved toward the object side during focusing from a distant object to a close object. The second lens group consists of, in order from the object side, a first cemented lens consisting of a biconvex lens and a negative lens having a smaller absolute value of curvature radius of the object-side surface than that of the image-side surface, and a second cemented lens as a whole having a positive refractive power and consisting of a negative lens having a smaller absolute value of curvature radius of the image-side surface than that of the object-side surface and a positive lens having a smaller absolute value of curvature radius of the object-side surface than that of the image-side surface. ... Fujifilm Corporation

03/30/17 / #20170090083

Laminate, infrared ray absorption filter, bandpass filter, method for manufacturing laminate, kit for forming bandpass filter, and image display device

A laminate includes a first area formed by applying a first composition and a second area formed by applying a second composition on a surface of the first area, and a difference between refractive indexes of the first area and the second area is 0.5 or greater, and the first areas and the second areas are alternately laminated.. . ... Fujifilm Corporation

03/30/17 / #20170090072

Polarizing plate protective film, polarizing plate, liquid crystal display device, and production method of polarizing plate protective film

The invention is directed to a polarizing plate protective film containing a polymer having at least one of an ester bond and an amide bond and a compound which generates a base by an action of an acid, a polarizing plate including the polarizing plate protective film and a polarizer, a liquid crystal display device including a liquid crystal cell and the polarizing plate, and a production method of a polarizing plate protective film including producing the polarizing plate protective film with a composition containing a polymer having at least one of an ester bond and an amide bond and a compound which generates a base by an action of an acid.. . ... Fujifilm Corporation

03/30/17 / #20170089883

Cell evaluation device, method, and program

Cell evaluation device includes a first evaluation unit that evaluates the similarity between cells to be evaluated and cell species, which are located closer to a non-differentiation side than the cells to be evaluated are in the process of differentiation of the cells to be evaluated, as a first similarity, a second evaluation unit that evaluates the similarity between the cells to be evaluated and cell species, which are located closer to a differentiation side than the cells to be evaluated are in the process of differentiation of the cells to be evaluated, as a second similarity, and a differentiation progress calculation unit that calculates the degree of progress of differentiation of the cells to be evaluated based on the first similarity and the second similarity.. . ... Fujifilm Corporation

03/30/17 / #20170088743

Resin composition for underlayer film formation, layered product, method for forming pattern, and process for producing device

A resin composition for underlayer film formation capable of forming an underlayer film having good adhesiveness and excellent surface flatness, a layered product, a method for forming a pattern and a process for producing a device are provided. The resin composition for underlayer film formation includes a resin having a group represented by general formula (a) and a group represented by general formula (b), and a solvent. ... Fujifilm Corporation

03/30/17 / #20170088731

Printing ink

An inkjet ink comprising a cyclic monofunctional (meth)acrylate monomer and a free radical photoinitiator package, which package includes a free radical photoinitiator having the following structure:. . ... Fujifilm Corporation

03/30/17 / #20170088681

Cellulose acylate film, production method of cellulose acylate film, stack, polarizing plate, and liquid crystal display device

A. Cellulose acylate film includes cellulose acylate and a compound a which has a group represented by the formula (g) as defined herein and in which a value obtained by dividing a molecular weight of the compound by a number of the groups represented by formula (g) contained in the compound is 200 or less, and a content of the compound a is 15% by weight or more based on a content of the cellulose acylate, the iodine diffusion index x as defined herein is less than 0.005 and the iodine diffusion index y as defined herein is 0.015 or more. ... Fujifilm Corporation

03/30/17 / #20170087915

Flexographic printing plate precursor for laser engraving and flexographic printing plate

An object of the present invention is to provide a flexographic printing plate precursor for laser engraving which makes it possible to obtain a flexographic printing plate having excellent solid quality and a wide printing pressure latitude and a flexographic printing plate which is obtained by laser-engraving the flexographic printing plate precursor for laser engraving. A flexographic printing plate precursor for laser engraving of the present invention includes a first resin layer, a second resin layer, and a support in this order, in which a thickness of the first resin layer is equal to or less than 0.03 mm, and a ratio of a dynamic hardness of the first resin layer to a dynamic hardness of the second resin layer is equal to or less than 0.9.. ... Fujifilm Corporation

03/30/17 / #20170087910

Inkjet printer and method of controlling inkjet printing

An inkjet printer includes: an optical reading device that optically reads at least one of an unprinted area on a printing paper sheet, a test chart printed area on a first printing in which a test chart is printed, and an image printed area on a second printing in which an image other than a test chart is printed, and acquires image data on the read area; an abnormal noise detecting device that analyzes the acquired image data and detects abnormal noise on a surface of a printing paper sheet; and a control device that changes at least a setting related to detection of an ejection state of an inkjet head or a printing state, or a setting related to printing correction, based on a state of the detected abnormal noise.. . ... Fujifilm Corporation

03/30/17 / #20170087874

Drying device, inkjet recording device, and drying method

There is provided a drying device including (i) a drying portion having a plurality of drying units, the drying unit configured to dry liquid droplets that have been jetted onto a recording medium with a drying intensity that varies along an intersecting direction intersecting a conveyance direction of the recording medium, with the plurality of drying units being provided along the conveyance direction, and (ii) a control portion that controls the drying intensity of the respective drying units according to an application amount of the liquid droplets in each of a plurality of divided regions, the divided regions defined by dividing the recording medium into regions along the respective directions of the conveyance direction and the intersecting direction.. . ... Fujifilm Corporation

03/30/17 / #20170087864

Printing device and ink circulation control method

A printing device includes a jetting section that jets out ink, a storage section that stores the ink, a supply channel through which the ink flows from the storage section toward the jetting section, a recovery channel through which the ink flows from the jetting section toward the storage section, a filter provided on at least one of the supply channel and the recovery channel, a pump provided on at least one of the supply channel and the recovery channel, and a control section. The control section applies control to the pump to make a flow speed of the ink in a non-printing period smaller than a flow speed of the ink in a printing period, the printing period including a period from a printing start time to a printing completion time, and the non-printing period being outside the printing period.. ... Fujifilm Corporation

03/30/17 / #20170086784

Acoustic wave diagnostic apparatus and control method thereof

There are provided an acoustic wave diagnostic apparatus capable of shortening the time until a color image is obtained and a control method thereof. Processing for transmitting an ultrasound pulse (43) converging on a focusing position (41) in the same direction of a subject from acoustic wave transducers to be driven, among a plurality of ultrasound transducers (20 to 32) included in an ultrasound probe, while sequentially updating the acoustic wave transducers to be driven is performed multiple times for the same ultrasound transducers (22 to 28). ... Fujifilm Corporation

03/30/17 / #20170086777

Radiation-source-to-image-surface distance obtainment apparatus, method and recording medium and radiographic image processing apparatus, method and recording medium

An image obtainment unit obtains plural radiographic-images generated by arranging plural storable-phosphor-sheets in such a manner that at least portions of the sheets are overlapped with each other in an irradiation direction of radiation, by arranging a marker at a position to be detected by the plural sheets, and by detecting the radiation that has passed through a subject and the marker by each of the plural sheets. A first-information obtainment unit obtains first-information representing a distance between detection surfaces of the plural sheets. ... Fujifilm Corporation

03/30/17 / #20170086773

Control device, radiographic imaging device, radiographic imaging method and program storage medium

A control device includes: a radiation source controller that is configured to control a radiation source such that, by moving the radiation source, an incident angle of radiation with respect to a detection face of a radiation detector is plural angles including a first angle where an incident direction of radiation with respect to the detection face is a direction of a normal line to the detection face, and plural second angles different from the first angle; and an imaging controller that is configured to effect control of performing radiographic imaging plural times at a position of the radiation source where the incident angle is the first angle, and performing radiographic imaging a number of times that is less than the plural times at each position of the radiation source where the incident angle is one of the second angles.. . ... Fujifilm Corporation

03/30/17 / #20170086770

Tomographic image generation device, method and recording medium

A first image obtaining unit obtains a plurality of projection images corresponding to different radiation source positions, the projection images being imaged under a first imaging condition for tomosynthesis imaging, and a second image obtaining unit obtains a two-dimensional image imaged with a given radiation source position under a second imaging condition for simple imaging. An image quality correction unit performs image quality correction on the projection images to compensate for a difference of image quality between the projection images and the two-dimensional image based on a difference between the first imaging condition and the second imaging condition. ... Fujifilm Corporation

03/30/17 / #20170086738

Biological sensor control device, operation method and operation program thereof, and biological sensor system

There are provided a biological sensor control device, an operation method and operation program thereof, and a biological sensor system capable of effectively using the power of a battery of a wearable biological sensor device within a measurement period. In a case where the measurement period of a wearable biological sensor device is shortened, a determination unit changes the driving conditions so as to increase the driving power of the wearable biological sensor device by increasing the number of measurement items and/or by shortening the measurement interval. ... Fujifilm Corporation

03/23/17 / #20170085750

Dither mask generation method and device

. . . . The dither mask generation method includes: a process of setting a nozzle relative ejection rate which is a control target of the nozzle ejection rate and stipulates a relative using ratio of the individual nozzles; a process of setting a nozzle pattern indicating correspondence relation between individual pixels of the dither mask and the nozzles in charge of recording at respective pixel positions; a process of setting an upper limit to the nozzle ejection rates of the individual nozzles for each raster in a main scanning direction, regarding at least some thresholds; and a process of setting the thresholds to the pixels of the dither mask based on the nozzle relative ejection rate, the nozzle pattern and a limitation by the upper limit.. . ... Fujifilm Corporation

03/23/17 / #20170085749

Dither mask generation method and device

The dither mask generation method includes: a process of setting a nozzle pattern indicating correspondence relation between individual pixels of the dither mask and the nozzles in charge of recording of respective pixel positions; a process of setting dot priority pixels to be candidates of a pixel to set a threshold among the pixels of the dither mask, based on the nozzle pattern; a process of setting the threshold to the pixel belonging to the dot priority pixels; and a process of changing the dot priority pixels before the threshold is set to all the dot priority pixels tentatively set by the dot priority pixel setting process regarding at least some thresholds.. . ... Fujifilm Corporation

03/23/17 / #20170084210

Decorative illumination ink jet recording material, decorative illumination image, method of forming the same, and decorative illumination signboard

To provide a decorative illumination ink jet recording material including a resin base, an ink accepting layer that contains at least white particles and is disposed on one surface of the resin base, and a protective layer that contains at least transparent particles and is disposed on the other surface of the resin base, a decorative illumination image, a method of forming the decorative illumination image, and a decorative illumination signboard.. . ... Fujifilm Corporation

03/23/17 / #20170084066

Template selection system, template selection method and recording medium storing template selection program

Provided are a template selection system, as well as a template selection method, and recording medium storing a template selection program, for selecting a template that will not appear incompatible with a target image when the target image is combined with the template. Specifically, a target image is selected and target image data representing the selected target image is transmitted to an image compositing server. ... Fujifilm Corporation

03/23/17 / #20170083795

Image processing device, image processing method and recording medium

In the image processing device, the image processing method and the recording medium, the image analyzer carries out image analysis on an image. The tag information assignor assigns the image with tag information corresponding to objects present in the image based on the result of the image analysis. ... Fujifilm Corporation

03/23/17 / #20170083784

Image processing apparatus, image processing method and recording medium storing image processing program

Provided are an image processing apparatus, as well as an image processing method and recording medium storing image processing program, in which it is possible to ascertain the number of times a particular kind of processing has been implemented with regard to an image. To achieve this, an image is analyzed and tag information possessed by the image is acquired. ... Fujifilm Corporation

03/23/17 / #20170083545

Image extraction system, image extraction method, image extraction program, and recording medium storing program

There are provided an image extraction system, an image extraction method, and an image extraction program for extracting images valuable to a user and a recording medium storing the program. An image set including three or more images is classified into a plurality of clusters, and an annotation indicating a subject or a scene of each image is acquired from a plurality of images included in each cluster. ... Fujifilm Corporation

03/23/17 / #20170082839

Zoom lens and imaging apparatus

A zoom lens is constituted by, in order from the object side to the image side: a positive first lens group which his fixed when changing magnification; at least two moving lens groups that move when changing magnification; and a positive final lens group which is fixed when changing magnification. The first lens group is constituted by, in order from the object side to the image side: a negative 1a lens group which is fixed during focusing operations, a positive 1b lens group which moves during focusing operations, and a positive 1c lens group which is fixed during focusing operations. ... Fujifilm Corporation

03/23/17 / #20170081628

Cell evaluation device, cell evaluation method, and cell evaluation program

Disclosed are a cell evaluation device, a cell evaluation method, and a non-transitory computer readable recording medium recorded with a cell evaluation program capable of evaluating individual cells in a cell image obtained by imaging a cell group with high accuracy. The cell evaluation device includes an image acquisition unit 30 that acquires a cell image obtained by imaging a cell group; a cell evaluation unit 32 that specifies an evaluation target cell and peripheral cells around the evaluation target cell in the cell group and evaluates the evaluation target cell based on evaluation results of the peripheral cells.. ... Fujifilm Corporation

03/23/17 / #20170081517

Novel azo compound and azo colorant

The present disclosure provides a compound represented by the following formula (1).. . ... Fujifilm Corporation

03/23/17 / #20170081073

Wraparound case

A wraparound case comprises: a case main body including a top face panel and a bottom face panel that face each other, a front face panel and a back face panel that face each other, a pair of side face panels that face each other, and an insertion flap that extends out from the top face panel and overlaps with the front face panel; a hinge section that is formed between the top face panel and the back face panel; a slit that is formed along a ridgeline between the top face panel and each of the pair of side face panels; and tear sections that couple a front face panel side and a back face panel side of the top face panel with the pair of side face panels, and that are torn when the top face panel is opened.. . ... Fujifilm Corporation

03/23/17 / #20170080735

Decorative illumination ink jet recording material, decorative illumination image, method of forming the same, and decorative illumination signboard

To provide a decorative illumination ink jet recording material having a resin base, an ink accepting layer that is disposed as an outermost layer and contains a resin, a layer that contains a metal oxide, and a white layer that contains white particles and a resin, a decorative illumination image, a method of forming the decorative illumination image, and a decorative illumination signboard.. . ... Fujifilm Corporation

03/23/17 / #20170080381

Gas separation process

A process for separating a feed gas comprising polar and non-polar gases into a gas mixture enriched in polar gas(es) and a gas mixture depleted in polar gas(es), the process comprising passing the feed gas through a gas separation unit comprising at least two gas-separation modules in order of decreasing selectivity for the polar gas(es), wherein the feed gas entering the gas separation unit comprises 1 to 35 mol % of polar gas(es).. . ... Fujifilm Corporation

03/23/17 / #20170080380

Gas separation process

A process for separating a feed gas comprising polar and non-polar gases into a gas mixture enriched in polar gas(es) and a gas mixture depleted in polar gas(es), the process comprising passing the feed gas through a gas separation unit comprising at least two gas-separation modules in order of increasing selectivity for the polar gas(es), wherein the feed gas entering the gas separation unit comprises more than 35 mol % and up to 90 mol % of polar gas(es).. . ... Fujifilm Corporation

03/23/17 / #20170079613

Ultrasound diagnostic apparatus and method of producing ultrasound image

An ultrasound diagnostic apparatus and a method of producing an ultrasound image capable of accurately determining the boundary of an intima-media complex in an ultrasound image and measuring an intima-media thickness with high precision are provided. A candidate vascular wall boundary point determiner determines one or more candidate vascular wall boundary points based on a sound ray signal extending in a scanning direction in an ultrasound image. ... Fujifilm Corporation

03/23/17 / #20170079599

Moisture feeling evaluation device, moisture feeling evaluation method, and moisture feeling evaluation program

In a moisture feeling evaluation device according to the present invention, an image input unit 1 receives an input of a captured image obtained by imaging a face f of a subject for which making up is performed, a brightness-color index calculation unit 10 calculates all of the amount of generated gloss, the amount of stain portions, and the amount of color irregularity portions as brightness-color indexes based on the captured image input to the image input unit 1, a shape index calculation unit 11 calculates all of the amount of wrinkle portions and the amount of pore portions as shape indexes based on the captured image input to the image input unit 1, and a moisture feeling evaluation unit 5 evaluates a feeling of visible moisture of the face f of the subject for which making up is performed based on the brightness-color indexes and the shape indexes.. . ... Fujifilm Corporation

03/16/17 / #20170077159

Light screening composition

. . The present invention is to provide a light screening composition that allow forming of a light screening film having excellent adhesiveness to a substrate and excellent residue removability at the time of development. The light screening composition according to the invention contains (a) any one of light screening particles and a light screening dye; (b) a dispersing resin; (c) a binder polymer having an acid value of 50 mg koh/g or less and a weight-average molecular weight of 8,000 to 50,000; and (d) a polymerizable compound.. ... Fujifilm Corporation

03/16/17 / #20170075222

Pattern forming method, resist pattern, method for manufacturing electronic device, and electronic device

A pattern forming method includes, in this order, forming a film on a substrate, using an active-light-sensitive or radiation-sensitive resin composition containing a resin (a) which has a repeating unit having a phenolic hydroxyl group, and a repeating unit having a group that decomposes by the action of an acid to generate a carboxyl group, and a compound (b) that generates an acid upon irradiation with active light or radiation; exposing the film; and developing the exposed film using a developer including an organic solvent, in which the developer including an organic solvent contains an organic solvent having 8 or more carbon atoms and 2 or less heteroatoms in the amount of 50% by mass or more.. . ... Fujifilm Corporation

03/16/17 / #20170075089

Imaging lens and imaging apparatus

An imaging lens includes, in order from the object side to the image side, a positive first lens group, a stop, a positive second lens group, and a positive third lens group. The first lens group includes, consecutively in order from the most object side thereof, a negative lens and a positive lens. ... Fujifilm Corporation

03/16/17 / #20170075052

Wavelength conversion member, backlight unit, polarizing plate, liquid crystal panel, and liquid crystal display device

Provided is a wavelength conversion member, including: a wavelength conversion layer containing a quantum dot which is excited by excitation light and emits fluorescent light; and an adjacent layer directly laminated on the wavelength conversion layer, in which the shape of an interface between the wavelength conversion layer and the adjacent layer includes an irregular shape formed of a concave portion and a convex portion. Provided are a backlight unit, a polarizing plate, a liquid crystal panel, and a liquid crystal display device: including the wavelength conversion member.. ... Fujifilm Corporation

03/16/17 / #20170073630

Cell determination device, cell determination method, and cell determination program

Disclosed are a cell determination device, a cell determination method, and a non-transitory computer readable recording medium recorded with a cell determination program capable of objectively determining a state of a cell with high accuracy. The cell determination device includes: a cell information acquisition unit 31 that acquires information relating to a proliferation rate of a cell and information relating to a movement distance of the cell per unit time based on plural cell images obtained by imaging the cell in a time series manner; and a determination unit 32 that determines a state of the cell based on the information relating to the proliferation rate and the information relating to the movement distance.. ... Fujifilm Corporation

03/16/17 / #20170071554

Tomographic image generation device, method and recording medium

An image obtaining unit obtains a plurality of projection images taken by imaging a subject with different radiation source positions. A frequency decomposition unit performs frequency decomposition on each of the projection images to obtain a plurality of band projection images representing frequency components for individual frequency bands for each of the projection images. ... Fujifilm Corporation

03/16/17 / #20170071504

Endoscope position identifying apparatus, endoscope position identifying method, and recording medium having an endoscope position identifying program recorded therein

An image obtaining unit obtains actual endoscope images, and a virtual endoscope image generating unit generates virtual endoscope images including a plurality of virtual endoscope branch images. A corresponding virtual endoscope image determining unit obtains a plurality of actual endoscope images which were obtained within a predetermined amount of time before the endoscope reached its current position, compares the plurality of actual endoscope images and the plurality of virtual endoscope branch images, and determines a corresponding virtual endoscope image that corresponds to the branch structure closest to the current position of the endoscope, through which the endoscope has passed. ... Fujifilm Corporation

03/16/17 / #20170071475

Photoacoustic image generation apparatus, signal processing device, and photoacoustic image generation method

An insertion needle 15 has a photoacoustic wave generating portion that generates a photoacoustic wave by absorbing light emitted from a laser unit 13. A photoacoustic image generation unit 25 generates a photoacoustic image based on the detection signal of the photoacoustic wave emitted from the insertion needle 15. ... Fujifilm Corporation

03/16/17 / #20170071232

Beverage composition

Provided is a beverage composition including a collagen peptide having an average molecular weight of from 1,000 to 3,000 and a reducing sugar, the beverage composition having a concentration of the collagen peptide of from 2,000 mg/10 ml to 4,000 mg/10 ml, a concentration of potassium of 3 mg/10 ml or less, and a concentration of magnesium of from 0.1 mg/10 ml or less, and a content of the reducing sugar being from 0.5 parts by mass to 3 parts by mass with respect to 100 parts by mass of the collagen peptide.. . ... Fujifilm Corporation

03/09/17 / #20170069344

Magnetic recording medium

The magnetic recording medium has a magnetic layer containing ferromagnetic powder and binder on a nonmagnetic support, wherein the ferromagnetic powder is hexagonal ferrite powder containing, based on number of particles, greater than or equal to 80% isotropic particles that satisfy the relation 1: major axis length/minor axis length <1.2, with an average particle size of the hexagonal ferrite powder being less than or equal to 30 nm, and a squareness in a vertical direction of the magnetic layer being greater than or equal to 0.65 but less than or equal to 1.00.. . ... Fujifilm Corporation

03/09/17 / #20170069064

Image processing device, imaging apparatus, image processing method, and program

An image processing unit 36 includes a frequency analysis unit 40, an optical characteristic acquisition unit 42, and a filter acquisition unit 44. The frequency analysis unit 40 acquires data in the frequency domain of each of first image data and second image data which are acquired by capturing an object image using a first optical system and a second optical system, respectively. ... Fujifilm Corporation

03/09/17 / #20170068073

Zoom lens and imaging apparatus

A zoom lens is constituted by, in order from the object side to the image side: a positive first group which is fixed when changing magnification, a negative second lens group which moves when changing magnification, a negative third lens group which moves when changing magnification, and a positive fourth lens group which is fixed when changing magnification. The first lens group is constituted by a 1a lens of a negative meniscus shape, a positive 1b lens, and a positive 1c lens. ... Fujifilm Corporation

03/09/17 / #20170068031

Laminate, method of producing the same, polarizing plate, liquid crystal display device, and organic el display device

The present invention is to provide a laminate that includes a polarizer and a photo alignment film and is excellent in the moisture-heat resistance of the polarizer, a method of producing a laminate, a polarizing plate, a liquid crystal display device, and an organic el display device including the laminate. The laminate of the present invention includes a polarizer, and a photo alignment film that is adjacently arranged on the polarizer, the photo alignment film is a layer formed by bringing a composition for forming a photo alignment film into direct contact with a surface of the polarizer, and the composition for forming a photo alignment film contains compound a having a photo-aligned group and compound b having a crosslinking group, or compound c having a photo-aligned group and a crosslinking group.. ... Fujifilm Corporation

03/09/17 / #20170067165

Conductive laminate for touch panel, touch panel, and transparent conductive laminate

The present invention provides a conductive laminate for a touch panel which includes a substrate, and a patterned metal layer which is visually recognized to have greater blackness when viewed from the substrate side; a touch panel; and a transparent conductive laminate. The conductive laminate includes a substrate which has two main surfaces; a patterned plated layer which is disposed on at least one main surface of the substrate and has a functional group that interacts with metal ions; and a patterned metal layer which is disposed on the patterned plated layer, in which the patterned plated layer includes a metal component constituting the patterned metal layer and the ratio of the average peak intensity resulting from the metal component contained in the patterned plated layer to the average peak intensity resulting from the metal component constituting the patterned metal layer is in a range of 0.5 to 0.95.. ... Fujifilm Corporation

03/09/17 / #20170066929

Instrument, protective sheet, and antibacterial film

Provided is an instrument including a hydrophilic processed portion on at least a portion of an outer surface thereof. The hydrophilic processed portion contains a hydrophilic polymer and a silver-containing antibacterial agent, and a water contact angle of a surface of the hydrophilic processed portion is equal to or less than 80°. ... Fujifilm Corporation

03/09/17 / #20170066268

Image recording apparatus and method of detecting defective recording element

Provided are an image recording apparatus that efficiently detects defective recording elements causing image defects in a plurality of recording heads and a method of detecting the defective recording elements. An image recording apparatus including: a plurality of recording heads; an indicator acquisition unit for acquiring an indicator which relatively indicates how easily image defects are visually perceived for each color, an appearance ratio setting unit for setting an appearance ratio of a test pattern as a higher value as the indicator of each color becomes higher; a recording unit for recording the test pattern of each color on a recording medium at the appearance ratio; an imaging unit for capturing an image of the test pattern which is recorded on the recording medium; and an analysis unit for analyzing the captured test pattern and detecting a defect of a recording element in the recording head.. ... Fujifilm Corporation

03/09/17 / #20170066262

Inkjet recording apparatus

An inkjet recording apparatus includes: a paper floating detecting unit which detects floating of a paper sheet at a first position; an ink jet recording unit which records an image on the paper sheet at a second position on a downstream side of the first position; and an image reader which reads the image on the paper sheet at a third position on the downstream side of the second position. When the floating is detected by the paper floating detecting unit, the image in a fixed front and rear range of the paper sheet is read by the image reader with a position where the floating is detected as a reference. ... Fujifilm Corporation

03/09/17 / #20170065259

Systems and methods of dissipating heat from a handheld medical imaging device

Systems and methods of transmitting heat out a medical imaging device are disclosed herein. In one embodiment, a medical imaging device includes a housing having electronics and a heat sink. ... Fujifilm Corporation

03/09/17 / #20170065255

Enhanced ultrasound imaging apparatus and associated methods of work flow

Enhanced ultrasound imaging apparatus and associated methods of work flow are disclosed herein. In one embodiment, a method of ultrasound scanning includes receiving a first dataset representing ultrasonic scanning of a target anatomy of a patient in a two-dimensional mode and generating a two-dimensional ultrasound image of the scanned target anatomy based on the received first dataset. ... Fujifilm Corporation

03/09/17 / #20170065253

Ultrasound transducer assembly

Ultrasound transducer assemblies and associated systems and method are disclosed herein. In one embodiment, an ultrasound transducer assembly includes at least one matching layer overlies a transducer layer. ... Fujifilm Corporation

03/09/17 / #20170065244

Radiographic image processing apparatus and method and recording medium storing therein radiographic image processing program

An image obtainment unit obtains a radiographic image radiographed by irradiating a subject with radiation. A first information obtainment unit obtains information about at least one of a radiography condition during radiography of the subject, a subject condition and detector characteristics, which are characteristics of the radiation detector. ... Fujifilm Corporation

03/02/17 / #20170064249

Endoscope imaging apparatus and endoscope

. . . . An imaging apparatus includes: an image sensor having a photodetecting surface which crosses a longitudinal axis of an insertion unit of an endoscope; and a circuit board which is mounted with the image sensor and includes: a sensor mounting portion which has plural sensor connection lands to which respective terminals of the image sensor are connected and faces a back surface, opposite to the photodetecting surface, of the image sensor; and a polygonal-prism-shaped cable connection portion which has plural cable connection lands being electrically continuous with the respective sensor connection lands and extends parallel with the longitudinal axis, wherein an outline of the cable connection portion is smaller than an outline of the sensor mounting portion when viewed from a distant point on an axis of the cable connection portion, and the cable connection lands are formed on plural side surfaces of the cable connection portion in a distributed manner.. . ... Fujifilm Corporation

03/02/17 / #20170062746

Photoelectric conversion element and imaging element

Provided is a photoelectric conversion element including: a lower electrode, a charge blocking layer which suppresses injection of a charge from the lower electrode, an organic layer which includes a photoelectric conversion layer, and an upper electrode which includes a transparent electrode layer, which are laminated in this order on a substrate. The photoelectric conversion layer is configured of an amorphous film and has a bulk hetero-structure of a p-type organic semiconductor and an n-type organic semiconductor formed of fullerenes. ... Fujifilm Corporation

03/02/17 / #20170061641

Method, apparatus, and recording medium for evaluating reference points, and method, apparatus, and recording medium for positional alignment

An initial position aligning unit performs initial positional alignment of a video and simulation data, and a position aligning unit performs positional alignment of the video and the simulation data. A first movement detecting unit detects movements of reference points which are set within a first image of the video, and a second movement detecting unit detects movement of a camera. ... Fujifilm Corporation

03/02/17 / #20170061618

Cell evaluation device, cell evaluation method, and cell evaluation program

The present invention provides a cell evaluation device, a cell evaluation method and a non-transitory computer readable recording medium storing a cell evaluation program capable of evaluating an evaluation target cell. The cell evaluation device includes an image acquisition unit that acquires a cell image obtained by imaging a cell group; a cell evaluation unit that specifies an evaluation target cell and peripheral cells around the evaluation target cell in the cell group, and evaluates the evaluation target cell based on evaluation results of the peripheral cells; and a boundary setting unit that sets a boundary in the cell image based on a state of the cell group, in which when specifying the peripheral cells, the cell evaluation unit specifies only cells that are present in a divided region where the evaluation target cell is present among plural divided regions divided by the boundary, as the peripheral cells.. ... Fujifilm Corporation

03/02/17 / #20170061611

Image alignment device, method, and program

There is provided an image registration device, method, and program that enable easy and quick initial registration between a target part included in an intraoperative video and simulation information, such as a simulation image. A first registration unit performs initial registration between an intraoperative video and simulation information. ... Fujifilm Corporation

03/02/17 / #20170061598

Fluoroscopic image density correction method, and image processing device

A reference density profile is generated in an outer circumference direction of a pipe having a reference welded portion on the basis of a reference fluoroscopic image generated from a radiation detection medium when a radiation source is disposed on a central axis of the pipe. A weld inspection density profile is generated in an outer circumference direction of a pipe having an inspection target welded portion on the basis of a weld inspection fluoroscopic image. ... Fujifilm Corporation

03/02/17 / #20170059990

Radiation-sensitive or actinic ray-sensitive resin composition, resist film using the same, mask blank, resist pattern forming method, electronic device manufacturing method, and electronic device

A radiation-sensitive or actinic ray-sensitive resin composition contains a polymer compound (a) including a structural part (a) that is decomposed by irradiation with actinic rays or radiation to generate an acid anion on a side chain and a repeating unit (b) that is represented by the following formula (i), in the formula, r3 represents a hydrogen atom, an organic group, or a halogen atom, a1 represents an aromatic ring group or an alicyclic group. R1 and r2 each independently represent an alkyl group, a cycloalkyl group, or an aryl group, at least two of a1, r1, or r2 may be bonded to each other to form a ring. ... Fujifilm Corporation

03/02/17 / #20170059850

Endoscope

An endoscope includes, in a tip portion of an insertion unit: an image sensor having a photodetecting surface as defined herein; an imaging optical system as defined herein; a holding frame as defined herein; and a tip portion of a treatment tool channel as defined herein, and, in a cross section taken perpendicularly to the optical axis, a thickness, on a first axis that intersects the optical axis and a center of the treatment tool channel, of frame wall portions, located on two respective sides of the optical axis and intersecting the first axis, of at least a portion of the holding frame is smaller than a thickness, on a second axis that is perpendicular to the optical axis and the first axis, of frame wall portions, located on two respective sides of the optical axis and intersecting the second axis, of the at least portion of the holding frame.. . ... Fujifilm Corporation

03/02/17 / #20170059833

Finder and imaging apparatus

A finder is a reverse galileo type finder comprising, in order from the object side to the eye point side: an objective lens group having a negative refractive power; and an eyepiece lens group having a positive refractive power. The distance between the objective lens group and the eyepiece lens group is the longest distance from among distances between lenses, as an air converted length, in an observation optical system from the objective lens group to the eyepiece lens group. ... Fujifilm Corporation

03/02/17 / #20170059817

Imaging lens and imaging apparatus

An imaging lens is constituted by, in order from the object side to the image side: a first lens having a negative refractive power and a concave surface toward the image side; a second lens having a negative refractive power; a third lens having a positive refractive power and a convex surface toward the image side; a fourth lens having a negative refractive power and a concave surface toward the image side; a biconvex fifth lens which is cemented to the fourth lens; and a sixth lens having a negative refractive power and a concave surface toward the object side.. . ... Fujifilm Corporation

03/02/17 / #20170057266

Examining apparatus, examining method and image recording apparatus

An examining apparatus, examining method and an image recording apparatus which analyze the state of a print image irrespective of variation in contrast performance of an optical unit of a reading device are provided. An examining apparatus includes: a reading device configured to read an image recorded by a recording head to output a reading result and including at least one optical unit including an image capturing element and a lens; an analyzing device configured to analyze a state of the recording head or a state of the image by comparing the reading result to a threshold; an index acquiring device configured to acquire an index indicating contrast performance for each divided reading region obtained by dividing a reading region of the reading device into a plurality of regions; and a correcting device configured to correct the threshold for the divided reading region based on the acquired index.. ... Fujifilm Corporation

03/02/17 / #20170057262

Recording head, recording head adjusting system, and recording head adjusting method

The present invention provides a recording head, a recording head adjusting system, and a recording head adjusting method. A recording head includes: a head module having a recording surface; a support member that supports the head module; a first direction position adjusting unit that adjusts the first-direction position of the head module; a rotation direction adjusting unit that adjusts the angular deviation of the rotation direction; and a position detection unit that detects the first-direction position of the head module that is used when performing adjustment by the first direction position adjusting unit and the rotation direction adjusting unit. ... Fujifilm Corporation

03/02/17 / #20170057124

Method of manufacturing transdermal absorption sheet and transdermal absorption sheet

An object is to provide a method of manufacturing a transdermal absorption sheet and a transdermal absorption sheet that can suppress generation of air bubbles. In the method of manufacturing the transdermal absorption sheet that includes a drug solution filling step, a drug solution drying step, a base solution filling step, a base solution drying step, and a peeling-off step in that order, each step of at least from the drug solution filling step to the base solution drying step is performed in an environment with a temperature of 1° c. ... Fujifilm Corporation

03/02/17 / #20170056828

Membrane stacks

A process for preparing a membrane stack comprising the steps of: (i) interposing a curable adhesive between alternate anion exchange membranes and cation exchange; and (ii) curing the adhesive; characterised in that said adhesive, when cured, has a shore a hardness of less than 70 and an elongation at break of at least 50%.. . ... Fujifilm Corporation

03/02/17 / #20170056826

Membrane stacks

A process for preparing a membrane stack comprising the steps of (i) interposing a curable adhesive between alternate anion exchange membranes and cation exchange; and (ii) curing the adhesive; characterised in that said membranes are in a swollen state when step (ii) is performed.. . ... Fujifilm Corporation

03/02/17 / #20170055933

Radiographic image processing device, method, and recording medium

A frequency decomposition unit performs frequency decomposition for a first radiographic image to acquire a plurality of band images. A scattered radiation removal unit calculates a scattered radiation component that is caused by a subject and is included in a second radiographic image which has a linear relationship with the amount of radiation, using the second radiographic image, and removes the scattered radiation component from the second radiographic image to acquire a scattered-radiation-removed radiographic image. ... Fujifilm Corporation

02/23/17 / #20170053671

Magnetic tape and method of manufacturing the same

. . The magnetic tape has a magnetic layer containing ferromagnetic powder and binder on the surface on one side of a nonmagnetic support and has a backcoat layer containing nonmagnetic powder and binder on the surface on the other side of the nonmagnetic support, wherein the backcoat layer is less than or equal to 0.30 μm in thickness; and the logarithmic decrement as determined by a pendulum viscoelasticity test on the surface on the backcoat layer side of the magnetic tape is less than or equal to 0.060.. . ... Fujifilm Corporation

02/23/17 / #20170053670

Magnetic tape and method of manufacturing the same

The magnetic tape has a magnetic layer containing ferromagnetic powder and binder on a nonmagnetic support, wherein the centerline average surface roughness ra as measured on the surface on the magnetic layer side of the magnetic tape is less than or equal to 1.8 nm, and the logarithmic decrement as determined by a pendulum viscoelasticity test on the surface on the magnetic layer side of the magnetic tape is less than or equal to 0.050.. . ... Fujifilm Corporation

02/23/17 / #20170053669

Magnetic tape and method of manufacturing the same

The magnetic tape has a nonmagnetic layer containing nonmagnetic powder and binder on a nonmagnetic support, and has a magnetic layer containing ferromagnetic powder and binder on the nonmagnetic layer, wherein the combined thickness of the magnetic layer and the nonmagnetic layer is less than or equal to 0.80 μm; and the logarithmic decrement as determined by a pendulum viscoelasticity test on the surface on the magnetic layer side of the magnetic tape is less than or equal to 0.050 and the coefficient of friction as measured on a base portion of the surface on the magnetic layer side is less than or equal to 0.35.. . ... Fujifilm Corporation

02/23/17 / #20170052643

Conductive film, display device having the same, and method of evaluating conductive film

In a conductive film, a display unit is formed such that forms of sub-pixels for two colors different from each other are different, cycles of sub-pixel array patterns of respective colors are different, or a barycenter of a single sub-pixel within a single pixel is at a position different from that of a straight line connecting barycenters of the other sub-pixels. In such a case, a wiring pattern is formed such that an indicator of evaluation of moirés is equal to or less than a predetermined value. ... Fujifilm Corporation

02/23/17 / #20170052639

Touch panel and method for manufacturing the same

A touch panel 10 includes a first electrode-side terminal portion 42a that is electrically connected to an upper detection electrode 36a. The first electrode-side terminal portion 42a includes a first resin layer 44a which is provided on a first substrate 34a and in which a first terminal groove 54a is formed and a first conductive material 48a which fills the first terminal groove 54a. ... Fujifilm Corporation

02/23/17 / #20170052296

Heat insulating window film, heat insulating window glass, building material, window, building, and vehicle

There is provided a heat insulating window film disposed on the inside of a window, including at least: a support; and a fibrous conductive particles-containing layer disposed on the support, in which the fibrous conductive particles-containing layer is disposed on a surface of the support on a side opposite to the surface of the window side, and the heat insulating window film contains a near infrared shielding material. The heat insulating window film; a heat insulating window glass; an building material; a window; a building; and a vehicle which are manufactured at low cost, easily manufactured to have a large area, and have excellent visible light transmittance, shielding properties for near infrared light, heat insulating properties, and light resistance are provided.. ... Fujifilm Corporation

02/23/17 / #20170052061

Membrane hydrophone for high frequency ultrasound and method of manufacture

A membrane hydrophone for analyzing high frequency ultrasound transducers has a piezoelectric membrane with electrode patterns created on the surface of the membrane. In one embodiment, the electrode patterns are doubled on each side of the membrane except for an active area of the hydrophone. ... Fujifilm Corporation

02/23/17 / #20170049418

Ultrasound diagnostic apparatus and doppler waveform image generating method

An ultrasound diagnostic apparatus includes a quadrature detection section configured to perform quadrature detection on reception radio-frequency data generated by a reception circuit to generate complex data, a frequency analyzer configured to perform a first frequency analysis using the complex data of a set number of sample points starting from a first start point and a second frequency analysis using at least one group of the complex data of the set number of sample points starting from a second start point that is different from the first start point, and to acquire a spectral signal corresponding to each pixel of a doppler waveform image based on results of the first frequency analysis and the second frequency analysis, and a doppler waveform image generator configured to generate the doppler waveform image using the spectral signal.. . ... Fujifilm Corporation

02/23/17 / #20170049308

Endoscope

An endoscope includes a first flat surface formed at a distal end portion of an insertion part to be inserted into a subject, and orthogonal to an axial direction of the insertion part, an observation window provided at the distal end portion for allowing image light of the subject to be taken therethrough, with a surface of the observation window as a light incidence plane, an illumination window provided at the distal end portion to irradiate a subject with illumination light, a fluid jetting nozzle arranged at the first flat surface to jet a fluid toward the observation window and fixed at the distal end portion of the insertion part, and an inclined surface formed around the observation window and arranged at a position that faces the fluid jetting nozzle.. . ... Fujifilm Corporation

02/16/17 / #20170048459

Distance measurement device, distance measurement method, and distance measurement program

. . A distance measurement device includes an imaging optical system, an imaging unit, an emission unit, a derivation unit which performs a distance measurement to derive a distance to a subject based on a timing at which directional light is emitted by the emission unit and a timing at which reflected light is received by a light receiving unit, a shake correction unit which performs shake correction as correction of shake of the subject image caused by variation of an optical axis of the imaging optical system, and a control unit which performs control such that the shake correction unit does not perform shake correction or performs shake correction with a correction amount smaller than a normal correction amount determined in advance in a case of performing the distance measurement and performs shake correction with the normal correction amount in a case of not performing the distance measurement.. . ... Fujifilm Corporation

02/16/17 / #20170046020

Medical assistance device, operation method and operation program thereof, and medical assistance system

A work list includes information display cells, in which work information regarding work performed on a patient by medical staff is displayed, and blank cells, in which no work information is displayed. The display mode of the work list is switched to a first display mode in which the blank cells are displayed without being deleted, a second display mode in which the blank cells are deleted so that the information display cells are aggregatively displayed by being packed together in the row direction, and a third display mode in which the blank cells are deleted so that the information display cells are aggregatively displayed by being packed together in the column direction.. ... Fujifilm Corporation

02/16/17 / #20170045617

Distance measurement device, distance measurement method, and distance measurement program

A distance measurement device includes an imaging unit which captures a subject image formed by an imaging optical system forming the subject image indicating a subject, an emission unit which emits directional light as light having directivity along an optical axis direction of the imaging optical system, a light receiving unit which receives reflected light of directional light from the subject, a derivation unit which derives a distance to the subject based on a timing at which directional light is emitted by the emission unit and a timing at which reflected light is received by the light receiving unit, and a control unit which performs control such that at least a part of an imaging period by the imaging unit overlaps at least a part of a distance measurement period by the emission unit, the light receiving unit, and the derivation unit.. . ... Fujifilm Corporation

02/16/17 / #20170045616

Distance measurement device, distance measurement method, and distance measurement program

A distance measurement device includes an imaging unit, an emission unit, a light receiving unit, a derivation unit which derives a distance to the subject based on a timing at which directional light is emitted and a timing at which reflected light is received, an execution unit which executes at least one of focus adjustment of an imaging optical system with respect to the subject or exposure adjustment prior to imaging by the imaging unit, and a control unit which performs control such that the timing at which at least one of focus adjustment or exposure adjustment is executed by the execution unit and the timing of a distance measurement by the emission unit, the light receiving unit, and the derivation unit are synchronized and performs control such that transition is performed to a state where actual exposure by the imaging unit is possible after the distance measurement is completed.. . ... Fujifilm Corporation

02/16/17 / #20170045358

Distance measurement device, distance measurement method, and distance measurement program

A distance measurement device includes an imaging unit, an emission unit which emits directional light as light having directivity to emit the directional light along an optical axis direction of an imaging optical system, a light receiving unit which receives reflected light of the directional light from a subject, a derivation unit which derives a distance to the subject based on a timing at which the directional light is emitted by the emission unit and a timing at which the reflected light is received by the light receiving unit, and a control unit which performs control such that the emission unit sets a timing, at which the directional light is emitted, to a predetermined period during which the influence of the emission of the directional light on an image signal is suppressed.. . ... Fujifilm Corporation

02/16/17 / #20170043556

Heat insulating window film, heat insulating material for window, and window

Provided is a heat insulating window film including a flexible support, and a fibrous metal particles-containing layer containing fibrous metal particles, in which the fibrous metal particles contain silver or an alloy of silver, an average short diameter of the fibrous metal particles is equal to or smaller than 35 nm and an average long diameter is equal to or greater than 5 μm, and a content per unit area of fibrous metal particles of the fibrous metal particles-containing layer is equal to or greater than 10 mg/m2.. . ... Fujifilm Corporation

02/16/17 / #20170042813

Liposome composition and method for producing same

Provided are a liposome composition in which an osmotic pressure of an inner water phase is 2-fold to 8-fold relative to the osmotic pressure of an outer water phase, and which encapsulates a water-soluble drug in a dissolved state, and also exhibits excellent preservation stability; and a method for producing the same. According to the present invention, it is possible to provide a liposome composition, including liposomes obtained from lipids dissolved and emulsified in an organic solvent, each of which has an inner water phase and an aqueous solution which constitutes an outer water phase and in which the liposomes are dispersed, in which each of the liposomes encapsulates a water-soluble drug in a dissolved state, and an osmotic pressure of the inner water phase is 2-fold to 8-fold relative to the osmotic pressure of the outer water phase; and a method for producing the same.. ... Fujifilm Corporation

02/16/17 / #20170042812

Method for producing liposome

Provided is a method for producing a liposome having safety and stability. According to the present invention, it is possible to provide a method for producing a liposome, including a step of mixing an oil phase with at least one lipid dissolved in an organic solvent and a water phase and stirring an aqueous solution containing the lipids, and a step of evaporating the organic solvent from the aqueous solution containing the liposomes obtained in the stirring step, in which the organic solvent is a mixed solvent of a water-soluble organic solvent and an ester-based organic solvent.. ... Fujifilm Corporation

02/16/17 / #20170042811

Liposome composition and method for producing same

Provided are a liposome composition which has a practically required long-term preservation stability, and which has a release rate of a drug on the order of several tens of hours due to releasability of a drug being able to be suitably controlled by rendering an inner water phase hyper-osmotic; and a method for producing the same. According to the present invention, it is possible to provide a liposome composition, including liposomes each of which has an inner water phase and an aqueous solution which constitutes an outer water phase and in which the liposomes are dispersed, in which the content of cholesterols is 10 mol % to 35 mol % with respect to the total amount of lipid components in the liposome composition, and each of the liposomes encapsulates a drug in a dissolved state, and an osmotic pressure of the inner water phase is 2-fold to 8-fold relative to the osmotic pressure of the outer water phase.. ... Fujifilm Corporation

02/16/17 / #20170042810

Liposome composition and method for producing same

Provided are a liposome composition which has a practically required long-term preservation stability, and which has a release rate of a drug on the order of several tens of hours due to releasability of a drug being able to be suitably controlled by rendering an inner water phase hyper-osmotic; and a method for producing the same. According to the present invention, it is possible to provide a liposome composition, including liposomes each of which has an inner water phase and an aqueous solution which constitutes an outer water phase and in which the liposomes are dispersed, in which each of the liposomes encapsulates a drug in a dissolved state, an osmotic pressure of the inner water phase is 2-fold to 8-fold relative to the osmotic pressure of the outer water phase, and a release rate of the drug from each of the liposomes is 10%/24 hr to 70%/24 hr in blood plasma at 37° c.; and a method for producing the same.. ... Fujifilm Corporation

02/09/17 / #20170041583

Electronic flash, electronic camera and light emitting head

. . . . An electronic camera having an electronic flash including a plurality of light emitting diodes (leds) that emit different wavelength light is disclosed. Electric energy is supplied to a capacitor to the leds. ... Fujifilm Corporation

02/09/17 / #20170038685

Active-light-sensitive or radiation-sensitive resin composition, active-light-sensitive or radiation-sensitive film and pattern forming method, each using composition, and method for manufacturing electronic device

An active-light-sensitive or radiation-sensitive resin composition includes a resin (a) and a photoacid generator (b) capable of generating an acid upon irradiation with active light or radiation, in which the active-light-sensitive or radiation-sensitive resin composition contains at least a photoacid generator (b1) represented by the following general formula (1) and a photoacid generator (b2) other than the photoacid generator (b1) as the photoacid generator (b).. . ... Fujifilm Corporation

02/09/17 / #20170038507

Infrared sensor, near-infrared ray absorption composition, photosensitive resin composition, compound, near-infrared ray absorption filter, and image pick-up device

The present invention relates to an infrared sensor, a near-infrared ray absorption composition, a photosensitive resin composition, a compound, a near-infrared ray absorption filter, and an image pick-up device. Provided is an infrared sensor 100 that detects an object by detecting light in wavelengths of 900 nm to 1,000 nm, including infrared ray transmission filters 113 and near-infrared ray absorption filters 111, in which the near-infrared ray absorption filters 111 contains a near-infrared ray absorption substance having a maximum absorption wavelength in wavelengths of 900 nm to 1,000 nm.. ... Fujifilm Corporation

02/09/17 / #20170037206

Curable compositions and membranes

A method for preparing an ionically-charged membrane comprising the steps (1) applying a film of curable composition to a support; (2) curing the film of curable composition to give anionically-charged membrane; and (3) removing the ionically-charged membrane from the support; wherein the curable composition comprises a) 5 to 50 wt % of curable compound comprising one ethylenically unsaturated group and anionic group; b) 10 to 70 wt % of crosslinking agent comprising at least two ethylenically unsaturated groups and having a molecular weight of at least 500 dalton per ethylenically unsaturated group; and c) 5 to 60 wt % of inert solvent.. . ... Fujifilm Corporation

02/09/17 / #20170036003

Transdermal absorption sheet and method of manufacturing transdermal absorption sheet

To provide a transdermal absorption sheet with which control of a dissolution rate and suppression of drug diffusion can be achieved, and a method of manufacturing the transdermal absorption sheet. A transdermal absorption sheet 100 is provided with a sheet portion 116, a plurality of frustum portions 114 that is disposed on the sheet portion 116, and needle portions 112 that are disposed on the frustum portions 114, each of the plurality of needle portions 112 includes a first layer 120 containing a drug and a second layer 122 not containing a drug, and at least one of the plurality of needle portions 112 contains an air bubble 124.. ... Fujifilm Corporation

02/02/17 / #20170034682

Initial rescue information collection device, operation method thereof, program, and system

. . . . An initial rescue information collection server includes a request receiving unit, a rescue request notification transmission unit, and a timeline processing unit. The request receiving unit receives a rescue request from a rescue requester who has sent the rescue request. ... Fujifilm Corporation

02/02/17 / #20170034496

Endoscope system and method of operating endoscope system

A light source including leds for emitting violet, blue, green and red light is controlled, to change over a first emission mode for emitting light of all the four colors for broadband illumination, and a second emission mode for emitting green light for correction. A color image sensor having blue, green and red pixels is controlled, and outputs b1, g1 and r1 image signals by imaging in the first emission mode, and b2, g2 and r2 image signals by imaging in the second emission mode. ... Fujifilm Corporation

02/02/17 / #20170032814

Magnetic recording medium

The magnetic recording medium has a nonmagnetic layer satisfying: the ratio of the total area accounted for by voids observed to the area of the observed region falls within a range of 13.0% to 25.0% in a sectional image taken by sem; r+σr is 58.0 nm or less and r−σr is 21.0 nm or greater when denoting the average value of the diameters of corresponding circles for voids observed in the sectional image as r, denoting the standard deviation of the diameters of the corresponding circles as σr; n+σn is 185 voids/μm2 or less and n−σn is 120 voids/μm2 or greater when denoting the average number of voids observed per μm2 unit area of the observed region in the sectional image as n, denoting the standard deviation of this number as σn; and the thickness of the nonmagnetic layer is 0.20 μm or greater.. . ... Fujifilm Corporation

02/02/17 / #20170032812

Magnetic tape and method of manufacturing the same

The magnetic tape has a magnetic layer containing ferromagnetic powder and binder on one surface of a nonmagnetic support, and has a backcoat layer containing nonmagnetic powder and binder on the other surface thereof, wherein the magnetic layer contains one or more components selected from the group consisting of a fatty acid and a fatty acid amide; the backcoat layer has a thickness of less than or equal to 0.30 μm and contains one or more components selected from the group consisting of a fatty acid and a fatty acid amide; a magnetic layer side c—h derived c concentration is greater than or equal to 45 atom %; and a backcoat layer side c—h derived c concentration is greater than or equal to 35 atom %.. . ... Fujifilm Corporation

02/02/17 / #20170032539

Image processing device, method for operating the same, and endoscope system

First rgb image signals are subjected to an input process. First color information is obtained from the first rgb image signals. ... Fujifilm Corporation

02/02/17 / #20170032443

Image processing apparatus, image processing method, and recording medium

In the image processing apparatus, the image processing method, the program and the recording medium, the first product material selector selects the first product material from among the plurality of product materials in accordance with the instruction of the user. The second product material selector selects the second product material that is different from the first product material from among the plurality of product materials. ... Fujifilm Corporation

02/02/17 / #20170032187

Image processing device, image processing method and recording medium

In the image processing device, the image processing method and the recording medium, the instruction acquiring section acquires the instruction input by the first user. The image group selecting section selects, as the second image group, a part of images from the first image group owned by the first user based on the instruction. ... Fujifilm Corporation

02/02/17 / #20170032181

Same person determination device and method, and control program therefor

A same person determination device, a same person determination method, and a control program of a computer of the same person determination device capable of determining whether persons are the same persons even when there are similar faces are provided. It is determined whether there are a plurality of approximation and non-approximation relationships in which a feature amount of one face of one image approximates to a feature amount of one face of the other image (yes in step 28), and the feature amount of the one face of the one image does not approximate to feature amounts of all other faces other than the one face of the other image (yes in step 29) (step 31). ... Fujifilm Corporation

02/02/17 / #20170032089

Medical support apparatus and system, and method of operating medical support apparatus

A medical support apparatus includes a grouping unit for grouping plural lesions of a patient body treated by an anticancer chemotherapy into plural groups according to clinical onsets of the lesions. An information generator creates therapeutic effect information of therapeutic effect of the anticancer chemotherapy for respectively the plural groups. ... Fujifilm Corporation

02/02/17 / #20170031141

Variable magnification optical system and imaging apparatus

A variable magnification optical system includes, in order from the object side: a positive first lens group, which is fixed when changing magnification; a negative second lens group that moves from the object side to the image side when changing magnification from the wide angle end to the telephoto end; and a rearward lens group having a positive refractive power throughout the entire variable magnification range that includes at least one lens group that moves when changing magnification. The first lens group includes, in order from the object side, a positive first lens group front group, a positive first lens group middle group, and a first lens group rear group constituted by a negative lens. ... Fujifilm Corporation

02/02/17 / #20170031140

Variable magnification optical system and imaging apparatus

A variable magnification optical system includes, in order from the object side: a positive first lens group; a negative second lens group; a positive third lens group; a negative fourth lens group; and a positive fifth lens group. When changing magnification from the wide angle end to the telephoto end, the first and third lens groups are fixed with respect to an image formation plane, the second lens group moves toward the image side, the fourth lens group moves, and the distance between the fourth and fifth lens groups changes. ... Fujifilm Corporation

02/02/17 / #20170030785

Stress measuring method, stress measuring member, and stress measuring set

The present invention provides a stress measuring method including: irradiating a photoelastic product including a measurement subject with light penetrating a linear polarizing film and a phase difference film in this order, and detecting reflected light from the product which is derived from the light via the phase difference film and the linear polarizing film in this order, in which in-plane retardation re (550) of the phase difference film with light having a wavelength of 550 nm satisfies 100 nm≦re (550 nm)≦700 nm, and in-plane retardation re (450) of the phase difference film with light having a wavelength of 450 nm satisfies re (450)/re (550)≧0.9, a stress measuring member including the linear polarizing film and the phase difference film, and a stress measuring set including the stress measuring member and a stress displaying member including a photoelastic layer.. . ... Fujifilm Corporation

02/02/17 / #20170029648

Pigment dispersion liquid, decorative material, transfer material for forming decorative material, substrate with decorative material, touch panel, information display device, and graft type silicone polymer

A pigment dispersion liquid includes a pigment dispersant; and a pigment, in which the pigment dispersant is a graft type silicone polymer denoted by general formula 1. In general formula 1, r1 to r10, r15 and r16 represent a hydrogen atom, a hydroxy group, an aryl group, or an alkyl group having 1 to 3 carbon atoms; r11 and r12 represent an arylene group or an alkylene group having 1 to 3 carbon atoms; y and z represent a single bond or a divalent organic linking group; a represents a group having a pigment adsorption portion; b represents a group having a structure denoted by general formula 2; 1 and n represent an integer of greater than or equal to 1; m represents an integer of greater than or equal to 0; and k represents an integer of greater than or equal to 1.. ... Fujifilm Corporation

02/02/17 / #20170029599

Dispersion composition, curable composition using the same, transparent film, microlens, and solid-state imaging device

There is provided a dispersion composition capable of forming a film being excellent in surface conditions, the dispersion composition containing metal oxide particles (a) having a primary particle diameter of 1 nm to 100 nm, a polymer compound (b) having an acid value of less than 120 mgkoh/g, which is represented by the following formula (1), and a solvent (c).. . ... Fujifilm Corporation

02/02/17 / #20170029586

Process for preparing membranes

A process for preparing an ion-exchange membrane having a textured surface profile comprising the steps (i) and (ii): (i) screen-printing a radiation-curable composition onto a membrane in a patterned manner; and (ii) irradiating and thereby curing the printed, radiation-curable composition; wherein the radiation-curable composition has a viscosity of at least 30 pa·s when measured at a shear rate of 0.1 s−1 at 20° c.. . ... Fujifilm Corporation

02/02/17 / #20170029356

Method for manufacturing a-bromoacetophenone compound

A method for manufacturing an α-bromoacetophenone compound includes brominating a specific phenyl compound by reacting the specific phenyl compound with bromine in a solvent including at least one organic acid ester compound so as to obtain the α-bromoacetophenone compound that is a liquid at 5° c. To 30° c.. ... Fujifilm Corporation

02/02/17 / #20170028751

Liquid ejection head, liquid ejection head production method and liquid ejection head production system

The liquid ejection head has a structure in which three or more head modules including a plurality of ejection elements are arranged along a single direction, and the liquid ejection head includes a first head module, a second head module and a third head module which are arranged in ascending order of slope of ejection volume distribution in the single direction or are arranged in descending order of the slope of the ejection volume distribution in the single direction, the slope of the ejection volume distribution in the single direction being evaluated by subtracting an ejection volume at one end part in the single direction from an ejection volume at the other end part in the single direction.. . ... Fujifilm Corporation

02/02/17 / #20170028711

Liquid ejection head production method and liquid ejection head production system

The production method for a liquid ejection head is provided, in which a first head module is set, a second candidate head module is selected, a first representative value of the first head module is acquired, a second representative value of the second candidate head module is acquired, an average value of the first representative value and the second representative value is derived, and the second candidate head module by which the derived average value is 0.76-fold or more and 1.24-fold or less of an average ejection volume target value is set as a second head module.. . ... Fujifilm Corporation

02/02/17 / #20170028676

Antireflection film and functional glass

An antireflection film includes an antireflection structure which has different reflectivity with respect to light to be incident on front and back surfaces, and includes a silver nano-disk layer formed by dispersing a plurality of silver nano-disks in a binder, and a layer of low refractive index which is formed on a surface of the silver nano-disk layer and has a refractive index smaller than a refractive index of the transparent substrate, and in which a ratio of a diameter of the silver nano-disk to a thickness is greater than or equal to 3, an area ratio of the silver nano-disk to the silver nano-disk layer is from 10% to 40%, and a pair of antireflection films having reflection conditions different from each other adhere to both surfaces of glass.. . ... Fujifilm Corporation

01/26/17 / #20170026552

Image processing device, image processing method and recording medium

. . In the image processing device, the image processing method and the recording medium, the image extractor extracts, from the captured images, captured images regarded as being captured in the same time range, as extracted images. The target image determiner selects an extracted image which were captured by a capturing person who captured largest number of extracted images and with a capturing device of a type used to capture largest number of extracted images, as a target image. ... Fujifilm Corporation

01/26/17 / #20170024863

Image processing device, imaging apparatus, image processing method, and program

An image processing unit 36 includes an information acquisition unit 40, a filter acquisition unit 42, and a filter processing unit 44. The information acquisition unit 40 acquires imaging information of original image data which is acquired by capturing an object image using an optical system. ... Fujifilm Corporation

01/26/17 / #20170024516

Information analysis assistance device, operation method and operation program thereof, and information analysis assistance system

There are provided an information analysis assistance device, an operation method and non-transitory computer readable medium storing an operation program thereof, and an information analysis assistance system. In a case where a date in a table is selected by a first selection method, a screen generation unit sets a first display format to display windows showing the outline of each piece of medical data side by side in a second display region. ... Fujifilm Corporation

01/26/17 / #20170024040

Touch panel and method for manufacturing the same

Provided are a touch-panel that is capable of reliably electrically connecting a terminal-portion and a flexible-printed-circuit board even in a case in which a groove formed in a resin layer is not completely filled with a conductive material in the terminal-portion and a method for manufacturing the touch-panel. A touch-panel includes a plurality of first terminal-portions that are provided so as to correspond to a plurality of first detection electrodes. ... Fujifilm Corporation

01/26/17 / #20170023858

Coloring composition, film, color filter, pattern forming method, method of manufacturing color filter, solid image pickup element, and infrared sensor

A coloring composition includes colorants, polymerizable compounds, and a resin, in which a ratio p/m of a mass p of the colorants to a mass m of the polymerizable compounds is 0.05 to 0.35, a content of the polymerizable compounds is 25 to 65 mass % with respect to a total solid content of the coloring composition, a ratio a/b of a minimum value a of an absorbance in a wavelength range of 400 nm or longer and shorter than 580 nm to a minimum value b of an absorbance in a wavelength range of 580 nm to 770 nm is 0.3 to 3, and a ratio c/d of a minimum value c of an absorbance in a wavelength range of 400 nm to 750 nm to a maximum value d of an absorbance in a wavelength range of 850 nm to 1300 nm is 5 or higher.. . ... Fujifilm Corporation

01/26/17 / #20170023825

Liquid crystal display device

A liquid crystal display device includes: a front-side polarizing plate having a front-side polarizer; a liquid crystal cell; and a rear-side polarizing plate having a rear-side polarizer in this order, in which a distance d1 from a central portion of the front-side polarizer to a central portion of the liquid crystal cell and a distance d2 from a central portion of the rear-side polarizer to the central portion of the liquid crystal cell are different from each other, in which a ratio between an x value, and the distance d1 and a y value, and the distance d2 rear-side polarizer is in a range of 1±0.12, a distance t1 between the front-side polarizing plate and the liquid crystal cell is 40 μm or more, and a distance t2 between the rear-side polarizing plate and the liquid crystal cell is in a range of 0 to 30 μm.. . ... Fujifilm Corporation

01/26/17 / #20170023779

Imaging lens and imaging apparatus

An imaging lens is constituted by, in order from the object side to the image side: a front group having a negative refractive power; and a rear group having a positive refractive power. The front group is constituted by two negative lenses. ... Fujifilm Corporation

01/26/17 / #20170023778

Imaging lens and imaging apparatus

An imaging lens is constituted by, in order from the object side to the image side: a front group; an aperture stop; and a rear group having a positive refractive power. The front group is constituted by, in order from the object side to the image side: at least two negative lenses, and a cemented lens formed by cementing a negative lens and a positive lens having a smaller abbe's number with respect to the d line than the negative lens, provided in this order from the object side to the image side, together. ... Fujifilm Corporation

01/26/17 / #20170022473

Method of culturing pluripotent stem cell, and polypeptide to be used therefor

A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by csyyqsc (seq id no:1) and an amino acid sequence represented by rgd; and (2) a second region containing (2-i) an amino acid sequence represented by prpslakkqrfrhrnrkgyrsqrghsrgrnqn (seq id no:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by seq id no:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by seq id no:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.. . ... Fujifilm Corporation

01/26/17 / #20170021631

Maintenance system of ink jet recording device

Provided is a maintenance system of an ink jet recording device which appropriately maintains an ink jet head and efficiently processes a job. In an ink jet recording device that acquires a job relevant to image recording and sequentially executes the job, the ejection state of the ink jet head is detected before the next job is executed. ... Fujifilm Corporation

01/26/17 / #20170021612

Method of testing print head, printing method, device for testing print head, and printer

A plurality of recording elements included in a printed head are grouped into a plurality of groups, a test order is set in units of groups, and a test of the recording elements is periodically performed in units of groups in the set test order. In a case where an abnormality is detected in the recording element as a result of the test, the recording element in which an abnormality is detected is recognized as a retest target, an order of tests is changed through interruption, and a retest of a group including the recording element recognized as a retest target is performed. ... Fujifilm Corporation

01/19/17 / #20170019737

Electroacoustic converter

. . . . . . . . . . . . . . . . . . An electroacoustic converter includes a piezoelectric film whose principal surface expands and contracts according to an electric field, a viscoelastic support which is in close contact with the principal surface of the piezoelectric film, a pressing member which presses the piezoelectric film to the viscoelastic support, and an expandable pressing sheet which is tensioned and in close contact with the surface of the piezoelectric film opposite to the viscoelastic support to press the piezoelectric film and the viscoelastic support. In a section in a predetermined direction perpendicular to the principal surface of the piezoelectric film, the piezoelectric film has a flat portion which is held by the pressing sheet and the viscoelastic support in a portion thereof excluding a pressed portion by the pressing member, and an inclined portion which is connected to the pressed portion and the flat portion and extends in a direction of intersecting the pressed portion. ... Fujifilm Corporation

01/19/17 / #20170018700

Piezoelectric polymer composite

In a piezoelectric polymer composite in which piezoelectric particles are dispersed in a polymer matrix, the piezoelectric particles include 5 vol % to 30 vol % of particles having a particle size which is 0.25 times to 1 time a thickness of the piezoelectric polymer composite. As a result, the piezoelectric polymer composite exhibits satisfactory piezoelectric characteristics.. ... Fujifilm Corporation

01/19/17 / #20170018079

Image processing device, method, and recording medium having stored therein program

A target place is set in an area of a human body structure having a tree structure in a three-dimensional image. The tree structure of the human body structure is extracted. ... Fujifilm Corporation

01/19/17 / #20170017157

Lithographic printing plate precursor and plate making method of lithographic printing plate

By a lithographic printing plate precursor including a support having provided thereon an image-recording layer capable of forming an image by supplying at least any of printing ink and dampening water on a printing machine after image exposure to remove an unexposed area thereof, wherein the image-recording layer contains an infrared absorbing agent, a polymerization initiator, a polymerizable compound and a polysaccharide having a sulfonic acid group or a group made by a salt thereof and a plate making method of a lithographic printing plate using the same, a lithographic printing plate precursor which exhibits good development property while maintaining printing durability of a lithographic printing plate after development and a plate making method of a lithographic printing plate using the same can be provided.. . ... Fujifilm Corporation

01/19/17 / #20170017118

Liquid crystal panel, liquid crystal display device, polarizing plate, and polarizing plate protective film

One embodiment of the present invention relates to a liquid crystal panel including a liquid crystal panel member including a visible side polarizer, a liquid crystal cell, and a backlight side polarizer; and an optical conversion member including an optical conversion layer containing a quantum dot emitting fluorescent light which is excited by incident excitation light, in which the optical conversion member is integrally laminated on a backlight side surface of the liquid crystal panel member, a liquid crystal display device, a polarizing plate, and a polarizing plate protective film.. . ... Fujifilm Corporation

01/19/17 / #20170017022

Optical conversion member, method for manufacturing optical conversion member, backlight unit including optical conversion member, and liquid crystal display device

Disclosed is an optical conversion member, including an optical conversion layer containing quantum dot emitting fluorescent light and an anisotropic light scattering layer having i (0°)/i (40°) of 3 or greater, in which i (0°) indicates a transmission light intensity of the anisotropic light scattering layer at the time of allowing light to be incident on the anisotropic light scattering layer from a normal direction of a surface of the anisotropic light scattering layer, and i (40°) indicates a transmission light intensity of the anisotropic light scattering layer in an azimuth in which a transmission light intensity of the anisotropic light scattering layer at the time of allowing light to be incident on the anisotropic light scattering layer from a direction of a tilt angle of 40° with respect to the normal direction of the surface of the anisotropic light scattering layer becomes a minimum value.. . ... Fujifilm Corporation

01/19/17 / #20170015484

Moisture-absorbing material, method for producing same, and blister pack

An embodiment of the present invention provides a moisture-absorbing material including, in the following order, a moisture-permeable polymer layer, a moisture-absorbing layer having a porous structure and including amorphous silica, a water-soluble resin, a moisture-absorbing agent, and at least one selected from plasticizers and resins having a glass transition temperature of 50° c. Or lower, and a moisture-proof layer.. ... Fujifilm Corporation

01/19/17 / #20170015087

Antireflection film, polarizing plate, cover glass, and image display device, and method for producing antireflection film

An antireflection film includes: a substrate; and an antireflection layer formed with a composition containing the components (a), (b) and (c) as defined herein, the antireflection layer contains a binder resin including at feast one of a structure derived from the following (b) and a structure derived from the following (c) and has a moth eye structure having an irregular shape formed with metal oxide particles of the following on a surface on a side opposite to an interface on the substrate side, and in the irregular shape of the antireflection layer, b/a which is a ratio between a distance a between peaks of adjacent convex portions and a distance ft between a center between peaks of the adjacent convex portions and a concave portion is 0.5 or greater:. . ... Fujifilm Corporation

01/19/17 / #20170014754

Gas separation composite and method of producing same

The present invention provides a gas separation composite which has high heat resistance and mechanical strength, prevents a support layer from being deformed or damaged by heat during formation of a gas separation membrane and heat during a gas separation operation, and properly supports a gas separation layer to obtain high gas permeability and gas separation properties; and a method of producing the gas separation composite. The gas separation composite includes a metal support having a plurality of through holes in the thickness direction and a gas separation layer laminated on the surface of the metal support. ... Fujifilm Corporation

01/19/17 / #20170014106

Ultrasound imaging system and method with automatic adjustment and/or multiple sample volumes

Adjustment of operation of an ultrasound imaging system may be based at least in part on one or more characteristics represented in ultrasound return signals from two or more sample volumes. Adjustment may include adjusting a principal sample volume location or selecting a new principal sample volume. ... Fujifilm Corporation

01/19/17 / #20170014099

Ultrasonic endoscope

The ultrasonic endoscope includes: an insertion part that includes a tip, a base end, and a longitudinal axis; an ultrasonic transducer that is provided at the tip of the insertion part; a locking groove that is a balloon mounting portion which is disposed closer to the base end of the insertion part than the ultrasonic transducer is and on which a balloon wrapping the ultrasonic transducer is detachably mounted; a balloon pipe line that extends in the insertion part; a tip-side opening surface of the balloon pipe line that is provided closer to the tip than the locking groove and has components normal to a direction of the longitudinal axis; and a groove portion which is formed toward the tip from the tip-side opening surface as a starting point and of which at least a part overlaps the ultrasonic transducer in the direction of the longitudinal axis.. . ... Fujifilm Corporation

01/19/17 / #20170014055

Endoscope system and method for operating the same

A control section performs first preliminary imaging in which an observation target is illuminated with first blue light at a wavelength band of 450±10 nm and an image of the observation target is captured. A yellow pigment concentration calculator calculates concentration of the yellow pigment based on an image signal obtained by performing the first preliminary imaging. ... Fujifilm Corporation

01/19/17 / #20170014019

Connector and endoscope system

There are provided a connector of which manufacture and maintenance are easy and an endoscope system. A connector is a connector for an endoscope that is connected to a light source device. ... Fujifilm Corporation

01/19/17 / #20170013842

Antibacterial layer-attached base material, antibacterial sheet, radiation photographing device, and touch panel

The present invention provides an antibacterial layer-attached base material which has excellent light resistance and includes an antibacterial layer exhibiting an antibacterial action within a short period of time, an antibacterial sheet, a radiation photographing device, and a touch panel. The antibacterial layer-attached base material of the present invention is an antibacterial layer-attached base material including: a base material; and an antibacterial layer which is disposed on at least a part of the surface of the base material, in which the antibacterial layer contains at least one antibacterial agent containing silver, and the amount of silver ions per a unit area measured in an extraction test is 15 to 50 ng/cm2.. ... Fujifilm Corporation

01/12/17 / #20170013243

Image processing device, imaging device, image processing method, and program

. . . . . . . . . . . . . . . . Provided are an image processing device, an imaging device, an image processing method, and a program that can obtain image data subjected to appropriate multi-area white balance processing subsequently while reducing required storage capacity. A white balance gain is acquired for each pixel of original image data (s11). ... Fujifilm Corporation

01/12/17 / #20170013242

Image processing device, imaging device, image processing method, and program

The number of light sources of original image data and the types of light source are determined (s11). A reference white balance gain which is set for each light source type of the original image data is acquired (s12). ... Fujifilm Corporation

01/12/17 / #20170013212

Image pickup device and method

In an image pickup device and method using a lens unit in which a plurality of lens arrays, are arranged and a lens holding unit is provided between the lens arrays, light emitted from the area corresponding to the lens holding unit can be detected. A moving mechanism that moves a lens unit or the observation target holding unit and the detection unit, and a moving mechanism control unit are provided. ... Fujifilm Corporation

01/12/17 / #20170013198

Camera shaking correction device and imaging apparatus

A control section 11 moves an imaging lens 1 based on a detection signal from an angular velocity detection section 6 so as to correct image blurring which occurs in captured image data obtained through imaging performed by an imaging element 3. The control section 11 calculates a first motion vector between first captured image data, which is obtained through imaging performed by the imaging element 3, and second captured image data which is obtained subsequent to the first captured image data and in which image blurring is corrected. ... Fujifilm Corporation

01/12/17 / #20170013166

Printing system, method of generating halftone processing rule, method of acquiring characteristic parameter, image processing device, image processing method, halftone processing rule, halftone image, method of manufacturing printed material, inkjet printing system, and program

There are provided a printing system, a method of generating a halftone processing rule, a method of acquiring a characteristic parameter, image processing device and method, a halftone processing rule, a halftone image, a method of manufacturing a printed material, an ink jet printing system, and a program which are capable of reducing an operation load of a user and acquiring a halftone processing rule appropriate for the printing system. A characteristic parameter acquisition chart (100) including a pattern for acquiring characteristic parameters related to characteristics of the printing system is output, and the output characteristic parameter acquisition chart (100) is read by image reading means. ... Fujifilm Corporation

01/12/17 / #20170013165

Image processing device and method, printing system, halftone process determination method, and program

There are provided image processing device and method, a printing system, a halftone process determination method, and a program capable of determining a processing rule of an appropriate halftone process appropriate for characteristics of a printing system. An image processing device (20) according to the present invention includes characteristic parameter acquisition means (52) for acquiring characteristic parameters related to characteristics of a printing system, and halftone process generation means (58) for generating halftone processing rules that define the processing contents of two or more kinds of halftone processes of which balances of priority for a plurality of requirements required in the halftone process are different based on the characteristic parameters acquired by the characteristic parameter acquisition means (52).. ... Fujifilm Corporation

01/12/17 / #20170012403

Laser device and photoacoustic measurement device comprising the same

In a laser device and a photoacoustic measurement device including the laser device, the intensity of light at each wavelength made independently controllable. The laser device includes a laser medium which has oscillation wavelengths at a first wavelength and a second wavelength with higher light emission efficiency than at the first wavelength, an excitation section, a first resonator, a second resonator, a q-value change unit, and a control section. ... Fujifilm Corporation

01/12/17 / #20170012072

Infrared sensor, near-infrared absorbing composition, cured film, near-infrared absorbing filter, image sensor, camera module, and compound

Provided are an infrared sensor, a near-infrared absorbing composition, a cured film, a near-infrared absorbing filter, an image sensor, a camera module, and a compound. An infrared sensor 100 which has an infrared transmitting filter 113 and a near-infrared absorbing filter 111 and detects objects by detecting light having wavelengths of 700 nm or longer and shorter than 900 nm, in which the near-infrared absorbing filter 111 includes a near-infrared absorbing substance having a maximum absorption wavelength at a wavelength of 700 nm or longer and shorter than 900 nm.. ... Fujifilm Corporation

01/12/17 / #20170011512

Cell recognition device, method, and program

A nucleolus detection unit, which detects nucleoli in a plurality of cells in a cell image obtained by imaging the cells, and a cell recognition unit, which acquires information indicating a distance between the nucleoli and recognizes the individual cells based on the information indicating the distance, are provided.. . ... Fujifilm Corporation

01/12/17 / #20170010720

Conductive sheet for touch panel and capacitive touch panel

In a second-conductive-sheet for a touch-panel, a plurality of upper-detection-electrodes disposed in a detection region and a plurality of second terminal wiring portions disposed in a peripheral wiring region to electrically connect the upper-detection-electrodes to second terminal portions and are formed. Each of the upper-detection-electrodes is made of a mesh-patterned first metal mesh having intersecting thin conductive metal wires, and each of the second terminal wiring portions is made of a mesh-patterned second metal mesh having intersecting thin conductive metal wires made of the same material as the thin conductive metal wires constituting each of the upper detection electrodes. ... Fujifilm Corporation

01/12/17 / #20170010528

Coloring composition, film, color filter, pattern forming method, method of manufacturing color filter, solid image pickup element, and infrared sensor

A coloring composition includes colorants and a resin, in which a ratio a/b of a minimum value a of an absorbance in a wavelength range of 400 to 830 nm to a maximum value b of an absorbance in a wavelength range of 1000 to 1300 nm is 4.5 or higher.. . ... Fujifilm Corporation

01/12/17 / #20170010455

Cell imaging control device, method, and program

The cell imaging control device includes a cell detection unit 22 that acquires a cell image by imaging transmitted light or reflected light of undyed cells and detects the cells or structures in the cells in the cell image and an autofocus control unit 24 that calculates an autofocus evaluation value based on image information of the cells or the structures detected by the cell detection unit 22 and outputs an autofocus control signal based on the autofocus evaluation value to an imaging device for capturing the cell image, which is an imaging device having an autofocus function.. . ... Fujifilm Corporation

01/12/17 / #20170010451

Optical element, extended optical element comprising optical element, and lamp housing

An optical element is constituted of a polygonal column-shaped transparent body which has four inner wall surfaces that surround a rectangular column-shaped space having a square-shaped opening when seen in a plan view, four outer wall surfaces that are respectively parallel to the inner wall surfaces, and two outer wall surfaces which are perpendicular to a diagonal line of the square-shaped opening and face each other, in which the distance between the two outer wall surfaces facing each other is longer than the diagonal line.. . ... Fujifilm Corporation

01/12/17 / #20170010441

Imaging lens and imaging apparatus

An imaging lens is constituted by, in order from the object side to the image side, a positive first lens group, a negative second lens group, and a positive third lens group. During focusing operations, the first lens group and the third lens group are fixed, while the second lens group moves. ... Fujifilm Corporation

01/12/17 / #20170010398

Composition, light reflecting film, luminance-improving film, backlight unit, and liquid crystal display device

There is provided a composition containing a discotic liquid crystal compound, a chiral agent, and a surfactant which can form a light reflecting layer formed by fixing a cholesteric liquid crystalline phase, which exhibits excellent durability under a hot and humid environment and excellent heat resistance, and has few alignment defects; a light reflecting film; a luminance-improving film; a backlight unit; and a liquid crystal display device.. . ... Fujifilm Corporation

01/12/17 / #20170009339

Gas barrier film and method of manufacturing gas barrier film

A gas barrier film includes a substrate film and an inorganic layer, in which the inorganic layer includes si, n, h, and o, the inorganic layer includes a uniform region having a thickness of more than 5 nm at the center in a thickness direction, in the uniform region, a ratio of si, n, h, and o is uniform and an o proportion is low, and either or both interface-contact regions of the inorganic layer are oxygen-containing regions in which the o proportion represented by the expression “o proportion: (number of o/total number of si, n, and o)×100%” increases in a direction from the uniform region side to an interface and in which a variation of the 0 proportion per unit thickness is 2%/nm to 8%/nm.. . ... Fujifilm Corporation

01/12/17 / #20170009138

Polymerizable compound, polymer, polymerizable composition, film, and half mirror for displaying projection image

The present invention provides a polymerizable compound denoted by formula (i): in the formula, z1 and z2 represent an arylene group, and the like, m represents 1 or 2, n represents an integer of 0 or 1, and when m is 2, n is 0, l1, l2, l3, and l4 each independently represent a linking group such as —c(═o)o— and —oc(═o)—, t3 represents -sp4-r4, x represents —o—, and the like, r represents 1 to 4, sp1, sp2, sp3, sp4, and sp5 each independently represent a single bond or a linking group, r1 and r2 each independently represent a polymerizable group, and r3, r4, and r5 each independently represent a hydrogen atom, a polymerizable group, or the like; a polymerizable composition containing the polymerizable compound described above; a film formed of the polymerizable composition described above; and a half mirror for displaying a projection image including the film described above.. . ... Fujifilm Corporation

01/12/17 / #20170007965

Process for preparing membranes

A process for preparing an ion-exchange membrane having a textured surface profile comprising the steps (i) and (ii): (i) applying a radiation-curable composition to a membrane in a patternwise manner; and (ii) irradiating and thereby curing the radiation-curable composition present on the membrane; wherein the radiation-curable composition comprises: a) 10 to 65 wt % of curable ionic compound(s) comprising one ethylenically unsaturated group; b) 3 to 60 wt % of crosslinking agent(s) comprising at least two ethylenically unsaturated groups and having a number average molecular weight below 800; c) 0 to 70 wt % of inert solvent(s); d) 0 to 10 wt % of free-radical initiator(s);and e) 0.5 to 25 wt % of thickening agent(s).. . ... Fujifilm Corporation

01/12/17 / #20170007538

Injection preparation and method for producing the same

Provided are an injection preparation which includes: an aqueous composition containing pemetrexed or a salt thereof, at least one antioxidant agent a which is selected from the group consisting of cysteine and a salt thereof, and of which the content is 0.001 mass % to 0.1 mass % with respect to the total mass of the aqueous composition, thioglycerol of which the content is 0.001 mass % to 0.1 mass % with respect to the total mass of the aqueous composition, and an aqueous solvent of which the content is greater than or equal to 50 mass % with respect to the total mass of the aqueous composition, and a container which seals the aqueous composition, in which the concentration of oxygen in gas within the container which seals the aqueous composition is less than or equal to 2.0 volume %, and a method for producing the injection preparation.. . ... Fujifilm Corporation

01/12/17 / #20170007294

Endoscopic surgical device, treatment tool, and guide member

An endoscope insertion part of an endoscope and a treatment tool insertion part of a treatment tool are insertable through an overtube inserted into a body wall, and a slider is provided for moving the endoscope insertion part and the treatment tool insertion part forward and backward in an interlocking manner. An operating part of the treatment tool includes a guide member that guides a cable part so as to be movable forward and backward in an axial direction so that the cable part of the endoscope is kept from being separated from the surface of the operating part beyond a fixed distance. ... Fujifilm Corporation

01/12/17 / #20170007293

Endoscopic surgical device and overtube

An endoscopic surgical device and an overtube that allows the state of a distal end of a treatment tool to be easily checked while reducing the diameter of the overtube and can improve surgical efficiency. An endoscope insertion part of an endoscope and a treatment tool insertion part of a treatment tool are insertable through an overtube inserted into a body wall, and a slider is provided for moving the endoscope insertion part and the treatment tool insertion part forward and backward in an interlocking manner. ... Fujifilm Corporation

01/12/17 / #20170007109

Overtube and endoscopic surgical device

A distal end of an endoscope insertion passage of an overtube is provided with a fluid supply and discharge port. When an observation window of the endoscope insertion part inserted through the endoscope insertion passage is cleaned, an operator can set a distal end surface at a predetermined positioning position using a positioning mechanism, without extracting the endoscope insertion part from the endoscope insertion passage. ... Fujifilm Corporation

01/12/17 / #20170007105

Syringe device and syringe plunger

A syringe device includes a syringe body; a first space defined inside the syringe body; a plunger body being slidable inside the syringe body and varies the volume of the first space; a second space defined inside the plunger body; a plunger rod being slidable inside the plunger body and varies the volume of the second space; a coil spring that urges the plunger rod in a direction expanding the volume of the second space; a first communication passage and a second communication passage that communicate the first space with the second space; and a check valve member that forms an orifice that restricts the flow of a fluid between the first space and the second space in the first communication passage, and a check valve that allows only the flow of the fluid from the second space to the first space in the second communication passage.. . ... Fujifilm Corporation

01/12/17 / #20170007102

Endoscopic surgical device and overtube

An overtube to be inserted into a body wall is provided with an endoscope insertion passage and a treatment tool insertion passage, the treatment tool insertion passage is provided parallel to a reference axis of the overtube, and the endoscope insertion passage is provided obliquely to the reference axis. A slider, which is engaged with the endoscope and the treatment tool inserted through the respective insertion passages and causes the endoscope and the treatment tool to interlock with each other and move forward and backward, is arranged inside the overtube so as to be movable in a forward-backward direction of the overtube. ... Fujifilm Corporation

01/12/17 / #20170007101

Sheathing tube and endoscopic surgical device

An outer port sheathing an overtube, includes: a first cylindrical member having a distal end opening from which the overtube is delivered; a second cylindrical member that is rotatably connected to the first cylindrical member and has a base end opening into which the overtube is introduced; rotation restriction means that restricts rotation of the overtube with respect to the second cylindrical member; a spring member that is deformable between a rotation locked state where rotation of the second cylindrical member with respect to the first cylindrical member is restricted by engagement of the spring member with the first cylindrical member, and a rotation unlocked state where the engagement is released and the rotation is allowed; and a rotation operating member that is rotatable in an axial direction of the second cylindrical member and deforms the spring member between the rotation locked state and the rotation unlocked state.. . ... Fujifilm Corporation

01/12/17 / #20170007100

Endoscopic surgical device, endoscope, and endoscope operating tool

An endoscope and a treatment tool are respectively inserted through an endoscope insertion passage and a treatment tool insertion passage of an overtube inserted into a body wall. A forward and backward movement operating part provided in a cable part provided to extend from a base end of an endoscope insertion part of the endoscope is arranged at a position adjacent to an operating part of the treatment tool. ... Fujifilm Corporation

01/12/17 / #20170007096

Endoscope

An endoscope includes in a tip portion of an insertion unit: an image sensor having plural terminals including a video terminal which outputs a video signal; and a tip potion of a treatment tool channel which extends in a longitudinal direction of the insertion unit, and a distance of the video terminal is longest among distances of the respective terminals from a center of the treatment tool channel in a plane that is perpendicular to the longitudinal axis.. . ... Fujifilm Corporation

01/05/17 / #20170006218

Image processing device, imaging device, image processing method, and image processing program

. . . . . . Disclosed are an image processing device, an imaging device, an image processing method, and an image processing program capable of, when recovering a deteriorated image due to a point spread function of an optical system, suppressing the occurrence of artifact and color gradation and achieving reduction in computational costs. The image processing device includes a frequency recovery processing unit which subjects image data acquired from an imaging element by capturing an object image using an optical system to frequency recovery processing using a frequency recovery filter based on a point spread function of the optical system, a gradation correction processing unit which subjects image data subjected to the frequency recovery processing to nonlinear gradation correction, and a phase recovery processing unit which subjects image data subjected to the gradation correction to phase recovery processing using a phase recovery filter based on the point spread function of the optical system.. ... Fujifilm Corporation

01/05/17 / #20170006202

Endoscope system and method of operating endoscope system

An endoscope system includes a color image sensor, having pixels sensitive to plural colors different from one another, for imaging an object. Plural leds discretely generate light of colors different from one another, to apply polychromatic light constituted by spectrally combining the light of the colors to the object. ... Fujifilm Corporation

01/05/17 / #20170006196

Display device

The present invention provides a display device which has a display unit on a main body, comprising a cover member that can be deformed into a first shape for covering the display unit and a second shape for forming a grip in order to solve the problems in the conventional cameras. The problem is such that the size of the camera becomes large by the size of the grip, which impairs portability of the camera because the conventional camera provides a fixed grip on the camera body on which a display unit with a large screen is mounted. ... Fujifilm Corporation

01/05/17 / #20170005282

Solar cell

A solar cell includes, on a support: a transparent negative electrode; auxiliary metal wiring that is in contact with the negative electrode; a positive electrode that faces the negative electrode; and a photoelectric conversion layer between the negative electrode and the positive electrode, and between the negative electrode and the photoelectric conversion layer, in which the electron transport layer includes an electron transport material and an insulating material, and the insulating material is a crosslinking macromolecule obtained by crosslinking a crosslinkable macromolecule with a compound having a plurality of crosslinkable groups.. . ... Fujifilm Corporation

01/05/17 / #20170004912

Method of manufacturing hexagonal ferrite powder, hexagonal ferrite powder, magnetic recording medium and method of manufacturing magnetic recording medium

The method of manufacturing hexagonal ferrite powder includes preparing a hexagonal ferrite precursor by mixing an iron salt and a divalent metal salt in a water-based solution, and converting the hexagonal ferrite precursor into hexagonal ferrite within a reaction flow passage, within which a fluid flowing therein is subjected to heating and pressurizing, by continuously feeding a water-based solution containing the hexagonal ferrite precursor and gelatin to the reaction flow passage.. . ... Fujifilm Corporation

01/05/17 / #20170004856

Magnetic recording medium and method of manufacturing the same

The magnetic recording medium has a magnetic layer comprising ferromagnetic powder and binder on a nonmagnetic support, wherein the ferromagnetic powder is ferromagnetic hexagonal ferrite powder, and the ferromagnetic hexagonal ferrite powder has a crystallite volume as determined by x-ray diffraction analysis ranges from 1,000 nm3 to 2,400 nm3, and a ratio of the crystallite size dx(107) obtained from a diffraction peak of a (107) plane to a particle size in a direction of an easy axis of magnetization dtem as determined by observation with a transmission electron microscope, dx(107)/dtem, is greater than or equal to 1.1.. . ... Fujifilm Corporation

01/05/17 / #20170004777

Display device and finder device

This finder display device is provided with a liquid crystal panel, a backlight, and a light source driving section. The backlight has a light guide having a side near which first to sixth light sources are disposed. ... Fujifilm Corporation

01/05/17 / #20170004606

Image processing device, imaging device, image processing method, and image processing program

Disclosed are an image processing device, an imaging device, an image processing method, and an image processing program capable of, when recovering a deteriorated image due to a point spread function of an optical system, effectively performing phase recovery and suppressing the occurrence of artifact due to frequency recovery processing. The image processing device includes a phase recovery processing unit which subjects image data acquired from an imaging element by capturing an object image using an optical system to phase recovery processing using a phase recovery filter based on a point spread function of the optical system, a gradation correction processing unit which subjects image data subjected to the phase recovery processing to nonlinear gradation correction, and a frequency recovery processing unit which subjects image data subjected to the gradation correction to frequency recovery processing using a frequency recovery filter based on the point spread function of the optical system.. ... Fujifilm Corporation

01/05/17 / #20170004603

Image processing device, imaging device, image processing method, and image processing program

There is provided an image processing device that acquires restored image data by performing restoration processing using a restoration filter based on the psf of an optical system for original image data acquired by capturing a subject image using the optical system. This device includes a restoration processing unit 38 that performs restoration processing by applying the restoration filter to the original image data, a quasi-focus region detection unit 50 that detects a quasi-focus region in an original image corresponding to the original image data, and a sharpness restoration control unit 37. ... Fujifilm Corporation

01/05/17 / #20170003923

Workflow creation support device, system, and method

A workflow creation support device includes: a job information capturing unit that captures job information including information on a plurality of parameters for specifying job contents; a narrowing processing unit that narrows a plurality of pre-registered templates as selection candidates, using information on at least some of the parameters from the information on the parameters; a selection-screen-data creating unit that creates selection screen data used for displaying information on the narrowed templates and displaying a selection screen for receiving an operation allowing a user to select one template from the selection candidates; and a job-definition-file creating unit that creates a job definition file based on information on the selected template and the information on the parameters.. . ... Fujifilm Corporation

01/05/17 / #20170003593

Photosensitive laminate, transfer material, patterned photosensitive laminate, method for manufacturing the same, touch panel, and image display device

An object of the invention is to provide a photosensitive laminate in which two or more layers can be collectively patterned, a transfer material, a patterned photosensitive laminate, a method for manufacturing the patterned photosensitive laminate, a touch panel, and an image display device. According to the invention, there are provided a photosensitive laminate in which a first resin layer, an interlayer, and a second resin layer are laminated on a support in this order, at least one of the first resin layer or the second resin layer includes 20 mass % or greater of inorganic particles, and exposure sensitivity of the second resin layer is higher than that of the first resin layer, a transfer material, a patterned photosensitive laminate, a method for manufacturing the patterned photosensitive laminate, a touch panel, and an image display device.. ... Fujifilm Corporation

01/05/17 / #20170003591

Manufacturing method for actinic ray-sensitive or radiation-sensitive resin composition, actinic ray-sensitive or radiation-sensitive resin composition, actinic ray-sensitive or radiation-sensitive film, mask blank comprising actinic ray-sensitive or radiation-sensitive film, photo mask, forming method for pattern, manufacturing method for electronic device, and electronic device

A manufacturing method for an actinic ray-sensitive or radiation-sensitive resin composition that contains a resin, an acid generator, an organic acid, and a solvent, includes at least one of (i), (ii), or (iii) below, and a content ratio of the organic acid in the actinic ray-sensitive or radiation-sensitive resin composition is greater than 5% by mass based on a total solid content in the composition; (i) dissolving the organic acid in a solution that does not substantially contain the resin and the acid generator, (ii) dissolving the organic acid in a solution that contains the acid generator and does not substantially contain the resin, and (iii) dissolving the organic acid in a solution that contains the resin and does not substantially contain the acid generator, an actinic ray-sensitive or radiation-sensitive resin composition, an actinic ray-sensitive or radiation-sensitive film, a mask blank including the film, a forming method for a photo mask and a pattern, a manufacturing method for an electronic device, and an electronic device.. . ... Fujifilm Corporation

01/05/17 / #20170003475

Lens device, imaging apparatus, and method of detecting position of movable lens

A lens device includes: a lens that is movable in an optical axis direction; a rotating member that rotates in conjunction with movement of the lens in the optical axis direction; a first signal detection section that detects a signal which changes in accordance with a position of the lens in the optical axis direction; a second signal detection section that detects a signal which changes in accordance with an amount of rotation of the rotating member; a first lens position detection section that detects the position of the lens based on the signal detected by the first signal detection section; a second lens position detection section that detects the position of the lens based on the signal detected by the second signal detection section; and a control section as defined herein.. . ... Fujifilm Corporation

01/05/17 / #20170002124

Curable composition, optical component and compound

A pigment dispersion containing a pigment dispersing agent having a partial structure denoted by general formula 1 described below and a pigment adsorption portion in the same molecule, a white pigment, and any one of a hydrocarbon-based solvent, a ketone-based solvent, an ester-based solvent, and an alcohol-based solvent (in general formula 1, r1 and r2 each independently represent an alkyl group having 1 to 4 carbon atoms, an alkoxyl group having 1 to 2 carbon atoms, or a hydrogen atom, and n represents a natural number), in which a white coated film having glossiness is obtained, and a b value of the coated film after being subjected to a high temperature treatment decreases; a white decorative material and a substrate attached with a white decorative material using the pigment dispersion, a transfer material for forming a white decorative material and a touch panel using the white decorative material and a substrate attached with a white decorative material, and the transfer material for forming a white decorative material; and an information display device using the touch panel.. . Provided are a curable composition exhibiting excellent solvent solubility while maintaining a high refractive index; an optical component using such a curable composition; and a compound. The curable composition contains a compound represented by the following formula (1) and at least one kind selected from thermal radical polymerization initiators or photo radical polymerization initiators. ... Fujifilm Corporation

01/05/17 / #20170001905

Method for manufacturing antireflection function-equipped lens

A dielectric multilayer film is formed on one surface of a lens main body, a film including aluminum is formed on the other surface of the lens main body, the film including aluminum is immersed in hot water without immersing the dielectric multilayer film in the hot water, thereby changing the film including aluminum to a fine uneven structure film including an alumina hydrate as a main component, whereby a lens provided with antireflection functions on both surfaces is manufactured.. . ... Fujifilm Corporation

01/05/17 / #20170001146

Disposable membrane stacks

A disposable, crossflow membrane stack suitable for use in an ion exchange unit, the stack comprising alternate dilution compartments and concentration compartments, each compartment being defined by a flat cation-permeable membrane (2) and a flat anion-permeable membrane (1) and at least two edges along which the cation-permeable and an anion-permeable membranes are permanently secured together wherein the cation-permeable membranes and/or the anion-permeable membranes have a textured surface profile which keep said membranes apart and/or from touching each other and wherein the edges secured together define the direction in which liquid may flow through the compartments. Also claimed are ion exchange units comprising the stack, optionally comprising a quick-release securement means to allow facile attachment and release of modular units comprising the stacks.. ... Fujifilm Corporation

01/05/17 / #20170000941

Centrifugal separation method

A storage portion forming a storage space 10, includes an inclined inner wall portion 20 that is connected to a base portion so that the diameter of the inclined inner wall portion gradually decreases; a concave portion 22 is formed at a part of the inclined inner wall portion; and the concave portion 22 includes a concave portion side surface 22b that is connected to a concave portion bottom surface 22a. The concave portion 22 is formed at a position, where the concave portion crosses an interface s between the specimen centrifuged during rotation and air, in a radial direction with respect to the central axis; and the maximum width of the concave portion 22 in a circumferential direction around the central axis is included in a range of 2 mm to a length of 20% of the whole circumference.. ... Fujifilm Corporation

01/05/17 / #20170000891

Food composition

A food composition comprising astaxanthin (a), a powder (b) of a sucrose fatty acid ester that is powdery at 25° c. And has an hlb value of 10 or more, and an oil (c) that is a liquid at 25° c., wherein the powder (b) is dispersed in a dispersion medium comprising the oil (c).. ... Fujifilm Corporation

01/05/17 / #20170000457

Hand-held medical imaging system with dedicated power source devices and associated apparatuses and methods

A portable ultrasound system having dedicated power source devices is disclosed herein. In one embodiment, a portable ultrasound system can include transducer electronics and a base unit having base-unit electronics configured to receive user input and to operate the transducer electronics to perform ultrasound scanning based on the user input. ... Fujifilm Corporation








ARCHIVE: New 2018 2017 2016 2015 2014 2013 2012 2011 2010 2009



###

This listing is an abstract for educational and research purposes is only meant as a recent sample of applications filed, not a comprehensive history. Freshpatents.com is not affiliated or associated with Fujifilm Corporation in any way and there may be associated servicemarks. This data is also published to the public by the USPTO and available for free on their website. Note that there may be alternative spellings for Fujifilm Corporation with additional patents listed. Browse our Agent directory for other possible listings. Page by FreshPatents.com

###